Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Pol delta |
Protein FULL name:
DNA polymerase III, Hys2p, Pol31p
Protein SHORT name:
POL31, HUS2, HYS2, SDP5
Pol delta (Saccharomyces cerevisiae) is product of expression of POL31 gene.
Pol delta is involved in:
BER in Saccharomyces cerevisiae
Keywords:
- mismatch repair (MMR)
- transcription-coupled repair NER (TCR-NER)
- nucleotide excision repair (NER)
- base excision repair (BER)
- long path BER (LP-BER)
- global genome repair NER (GGR-NER)
- DNA polymerase
FUNCTION: DNA polymerase delta (DNA polymerase III) participates in chromosomal DNA replication. It is required during synthesis of the leading and lagging DNA strands at the replication fork and binds at/or near replication origins and moves along DNA with the replication fork. It has 3'-5' proofreading exonuclease activity that correct errors arising during DNA replication. It is also involved in DNA synthesis during DNA repair.
CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).
SUBUNIT: DNA polymerase delta is a heterotrimer of POL3, POL32 and HYS2.
INTERACTION: P15436:POL3; NbExp=2; IntAct=EBI-6080, EBI-6134;
SUBCELLULAR LOCATION: Nucleus (By similarity).
MISCELLANEOUS: Present with 626 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the DNA polymerase delta/II small subunit family.
| NCBI GenPept GI number(s): |
1256943 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P46957 |
P46957 |
| PFAM: | - |
P46957 (Link - using uniprot id) |
| InterPro: | - |
P46957 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MDALLTKFNEDRSLQDENLSQPRTRVRIVDDNLYNKSNPFQLCYKKRDYG SQYYHIYQYRLKTFRERVLKECDKRWDAGFTLNGQLVLKKDKVLDIQGNQ PCWCVGSIYCEMKYKPNVLDEVINDTYGAPDLTKSYTDKEGGSDEIMLED ESGRVHLVGDFIRSTPFITGVVVGILGMEAEAGTFQVLDICYPTPLPQNP FPAPIATCPTRGKIALVSGLNLNNTSPDRLLRLEILREFLMGRINNKIDD ISLIGRLLICGNSVDFDIKSVNKDELMISLTEFSKFLHNILPSISVDIMP GTNDPSDKSLPQQPFHKSLFDKSLESYFNGSNKEILNLVTNPYEFSYNGV DVLAVSGKNINDICKYVIPSNDNGESENKVEEGESNDFKDDIEHRLDLME CTMKWQNIAPTAPDTLWCYPYTDKDPFVLDKWPHVYIVANQPYFGTRVVE IGGKNIKIISVPEFNSTGMIILLDLETLEAETVKIDI |
References:
| Title | Authors | Journal |
| HYS2, an essential gene required for DNA replication in Saccharomyces cerevisiae. | Sugimoto K, Sakamoto Y, Takahashi O, Matsumoto K | Nucleic Acids Res Sept. 11, 1995 |
| Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X. | Galibert F, Alexandraki D, Baur A, Boles E, Chalwatzis N, Chuat JC, Coster F, Cziepluch C, De Haan M, Domdey H, Durand P, Entian KD, Gatius M, Goffeau A, Grivell LA, Hennemann A, Herbert CJ, Heumann K, Hilger F, Hollenberg CP, Huang ME, Jacq C, Jauniaux JC, Katsoulou C, Karpfinger-Hartl L, et al. | EMBO J May 1, 1996 |
| The second subunit of DNA polymerase III (delta) is encoded by the HYS2 gene in Saccharomyces cerevisiae. | Hashimoto K, Nakashima N, Ohara T, Maki S, Sugino A | Nucleic Acids Res Feb. 15, 1998 |
| Characterization of the two small subunits of Saccharomyces cerevisiae DNA polymerase delta. | Gerik KJ, Li X, Pautz A, Burgers PM | J Biol Chem July 31, 1998 |
| Structure of DNA polymerase delta from Saccharomyces cerevisiae. | Johansson E, Majka J, Burgers PM | J Biol Chem Nov. 23, 2001 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| A multidimensional chromatography technology for in-depth phosphoproteome analysis. | Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H | Mol Cell Proteomics July 1, 2008 |
Last modification of this entry: Oct. 19, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|