Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Pol delta

Protein FULL name:

DNA polymerase III, Hys2p, Pol31p


Protein SHORT name:

POL31, HUS2, HYS2, SDP5


Pol delta (Saccharomyces cerevisiae) is product of expression of POL31 gene.


Pol delta is involved in:

BER in Saccharomyces cerevisiae
     
MMR in Saccharomyces cerevisiae
     
NER in Saccharomyces cerevisiae
     


Keywords:



FUNCTION: DNA polymerase delta (DNA polymerase III) participates in chromosomal DNA replication. It is required during synthesis of the leading and lagging DNA strands at the replication fork and binds at/or near replication origins and moves along DNA with the replication fork. It has 3'-5' proofreading exonuclease activity that correct errors arising during DNA replication. It is also involved in DNA synthesis during DNA repair.

CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).

SUBUNIT: DNA polymerase delta is a heterotrimer of POL3, POL32 and HYS2.

INTERACTION: P15436:POL3; NbExp=2; IntAct=EBI-6080, EBI-6134;

SUBCELLULAR LOCATION: Nucleus (By similarity).

MISCELLANEOUS: Present with 626 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the DNA polymerase delta/II small subunit family.


NCBI GenPept GI number(s): 1256943
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P46957 P46957
PFAM: - P46957 (Link - using uniprot id)
InterPro: - P46957 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MDALLTKFNEDRSLQDENLSQPRTRVRIVDDNLYNKSNPFQLCYKKRDYG
SQYYHIYQYRLKTFRERVLKECDKRWDAGFTLNGQLVLKKDKVLDIQGNQ
PCWCVGSIYCEMKYKPNVLDEVINDTYGAPDLTKSYTDKEGGSDEIMLED
ESGRVHLVGDFIRSTPFITGVVVGILGMEAEAGTFQVLDICYPTPLPQNP
FPAPIATCPTRGKIALVSGLNLNNTSPDRLLRLEILREFLMGRINNKIDD
ISLIGRLLICGNSVDFDIKSVNKDELMISLTEFSKFLHNILPSISVDIMP
GTNDPSDKSLPQQPFHKSLFDKSLESYFNGSNKEILNLVTNPYEFSYNGV
DVLAVSGKNINDICKYVIPSNDNGESENKVEEGESNDFKDDIEHRLDLME
CTMKWQNIAPTAPDTLWCYPYTDKDPFVLDKWPHVYIVANQPYFGTRVVE
IGGKNIKIISVPEFNSTGMIILLDLETLEAETVKIDI

References:

Title Authors Journal
HYS2, an essential gene required for DNA replication in Saccharomyces cerevisiae. Sugimoto K, Sakamoto Y, Takahashi O, Matsumoto K Nucleic Acids Res Sept. 11, 1995
Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X. Galibert F, Alexandraki D, Baur A, Boles E, Chalwatzis N, Chuat JC, Coster F, Cziepluch C, De Haan M, Domdey H, Durand P, Entian KD, Gatius M, Goffeau A, Grivell LA, Hennemann A, Herbert CJ, Heumann K, Hilger F, Hollenberg CP, Huang ME, Jacq C, Jauniaux JC, Katsoulou C, Karpfinger-Hartl L, et al. EMBO J May 1, 1996
The second subunit of DNA polymerase III (delta) is encoded by the HYS2 gene in Saccharomyces cerevisiae. Hashimoto K, Nakashima N, Ohara T, Maki S, Sugino A Nucleic Acids Res Feb. 15, 1998
Characterization of the two small subunits of Saccharomyces cerevisiae DNA polymerase delta. Gerik KJ, Li X, Pautz A, Burgers PM J Biol Chem July 31, 1998
Structure of DNA polymerase delta from Saccharomyces cerevisiae. Johansson E, Majka J, Burgers PM J Biol Chem Nov. 23, 2001
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics July 1, 2008


Last modification of this entry: Oct. 19, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.