Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Phr1p

Protein FULL name:

CPD photolyase, DNA photolyase


Phr1p (Saccharomyces cerevisiae) is product of expression of PHR1 gene.



Keywords:



FUNCTION: Involved in repair of UV radiation-induced DNA damage. Catalyzes the light-dependent monomerization (300-600 nm) of cyclobutyl pyrimidine dimers (in cis-syn configuration), which are formed between adjacent bases on the same DNA strand upon exposure to ultraviolet radiation.

CATALYTIC ACTIVITY: Cyclobutadipyrimidine (in DNA) = 2 pyrimidine residues (in DNA).

COFACTOR: Binds 1 FAD per subunit.

COFACTOR: Binds 1 5,10-methenyltetrahydrofolate non-covalently per subunit.

BIOPHYSICOCHEMICAL PROPERTIES: Absorption: Abs(max)=377 nm; Note=Has a fluorescence excitation maximum at 390 nm and an emission maximum at 475 nm;

SUBUNIT: Monomer (By similarity).

INTERACTION: P15179:MSD1; NbExp=1; IntAct=EBI-13385, EBI-18659; P33203:PRP40; NbExp=1; IntAct=EBI-13385, EBI-701;

SUBCELLULAR LOCATION: Nucleus. Mitochondrion.

MISCELLANEOUS: There are only 150-300 molecules of photolyase per yeast cell.

MISCELLANEOUS: Present with 688 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the DNA photolyase class-1 family.

SIMILARITY: Contains 1 DNA photolyase domain.


NCBI GenPept GI number(s): 1420831
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P05066 P05066
PFAM: - P05066 (Link - using uniprot id)
InterPro: IPR002081
IPR005101
IPR006050
IPR006051
IPR002081
IPR005101
IPR006050
IPR006051
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MKRTVISSSNAYASKRSRLDIEHDFEQYHSLNKKYYPRPITRTGANQFNN
KSRAKPMEIVEKLQKKQKTSFENVSTVMHWFRNDLRLYDNVGLYKSVALF
QQLRQKNAKAKLYAVYVINEDDWRAHMDSGWKLMFIMGALKNLQQSLAEL
HIPLLLWEFHTPKSTLSNSKEFVEFFKEKCMNVSSGTGTIITANIEYQTD
ELYRDIRLLENEDHRLQLKYYHDSCIVAPGLITTDRGTNYSVFTPWYKKW
VLYVNNYKKSTSEICHLHIIEPLKYNETFELKPFQYSLPDEFLQYIPKSK
WCLPDVSEEAALSRLKDFLGTKSSKYNNEKDMLYLGGTSGLSVYITTGRI
STRLIVNQAFQSCNGQIMSKALKDNSSTQNFIKEVAWRDFYRHCMCNWPY
TSMGMPYRLDTLDIKWENNPVAFEKWCTGNTGIPIVDAIMRKLLYTGYIN
NRSRMITASFLSKNLLIDWRWGERWFMKHLIDGDSSSNVGGWGFCSSTGI
DAQPYFRVFNMDIQAKKYDPQMIFVKQWVPELISSENKRPENYPKPLVDL
KHSRERALKVYKDAM

Phr1p (Saccharomyces cerevisiae) is able to recognize following damages:
References:

Title Authors Journal
Homology between the photoreactivation genes of Saccharomyces cerevisiae and Escherichia coli. Yasui A, Langeveld SA Gene Jan. 1, 1985
Sequence of the Saccharomyces cerevisiae PHR1 gene and homology of the PHR1 photolyase to E. coli photolyase. Sancar GB Nucleic Acids Res Nov. 25, 1985
Purification of the yeast PHR1 photolyase from an Escherichia coli overproducing strain and characterization of the intrinsic chromophores of the enzyme. Sancar GB, Smith FW, Heelis PF J Biol Chem Nov. 15, 1987
The role of conserved amino acids in substrate binding and discrimination by photolyase. Baer ME, Sancar GB J Biol Chem Aug. 5, 1993
The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. Nature May 1, 1997
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Light-driven enzymatic catalysis of DNA repair: a review of recent biophysical studies on photolyase. Weber S Biochim Biophys Acta Jan. 25, 2005


Last modification of this entry: Nov. 11, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.