Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Pol32p

Pol32p (Saccharomyces cerevisiae) is product of expression of POL32 gene.



Keywords:



FUNCTION: DNA polymerase delta (DNA polymerase III) participates in chromosomal DNA replication. It is required during synthesis of the leading and lagging DNA strands at the replication fork and binds at/or near replication origins and moves along DNA with the replication fork. It has 3'-5' proofreading exonuclease activity that correct errors arising during DNA replication. It is also involved in DNA synthesis during DNA repair.

SUBUNIT: DNA polymerase delta is a heterotrimer of POL3, POL32 and HYS2. POL32 can form homodimers.

INTERACTION: Q03392:pcn1 (xeno); NbExp=1; IntAct=EBI-6084, EBI-768724;

SUBCELLULAR LOCATION: Nucleus (By similarity).

MISCELLANEOUS: Present with 2410 molecules/cell in log phase SD medium.


NCBI GenPept GI number(s): 6322503
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P47110 P47110
PFAM: - P47110 (Link - using uniprot id)
InterPro: - P47110 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MDQKASYFINEKLFTEVKPVLFTDLIHHLKIGPSMAKKLMFDYYKQTTNA
KYNCVVICCYKDQTIKIIHDLSNIPQQDSIIDCFIYAFNPMDSFIPYYDI
IDQKDCLTIKNSYELKVSESSKIIERTKTLEEKSKPLVRPTARSKTTPEE
TTGRKSKSKDMGLRSTALLAKMKKDRDDKETSRQNELRKRKEENLQKINK
QNPEREAQMKELNNLFVEDDLDTEEVNGGSKPNSPKETDSNDKDKNNDDL
EDLLETTAEDSLMDVPKIQQTKPSETEHSKEPKSEEEPSSFIDEDGYIVT
KRPATSTPPRKPSPVVKRALSSSKKQETPSSNKRLKKQGTLESFFKRKAK

Pol32p (Saccharomyces cerevisiae) is able to recognize following damages:
References:

Title Authors Journal
Analysis of a 42.5 kb DNA sequence of chromosome X reveals three tRNA genes and 14 new open reading frames including a gene most probably belonging to the family of ubiquitin-protein ligases. Huang ME, Chuat JC, Galibert F Yeast June 1, 1995
Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X. Galibert F, Alexandraki D, Baur A, Boles E, Chalwatzis N, Chuat JC, Coster F, Cziepluch C, De Haan M, Domdey H, Durand P, Entian KD, Gatius M, Goffeau A, Grivell LA, Hennemann A, Herbert CJ, Heumann K, Hilger F, Hollenberg CP, Huang ME, Jacq C, Jauniaux JC, Katsoulou C, Karpfinger-Hartl L, et al. EMBO J May 1, 1996
Characterization of the two small subunits of Saccharomyces cerevisiae DNA polymerase delta. Gerik KJ, Li X, Pautz A, Burgers PM J Biol Chem July 31, 1998
Structure of DNA polymerase delta from Saccharomyces cerevisiae. Johansson E, Majka J, Burgers PM J Biol Chem Nov. 23, 2001
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry. Chi A, Huttenhower C, Geer LY, Coon JJ, Syka JE, Bai DL, Shabanowitz J, Burke DJ, Troyanskaya OG, Hunt DF Proc Natl Acad Sci U S A Jan. 13, 2007
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res April 1, 2007
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics July 1, 2008


Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.