Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RecA

Protein FULL name:

RecA [Escherichia coli].


RecA (Escherichia coli strain K-12 substr. MG1655) is product of expression of recA gene.


RecA is involved in:

HRR in Escherichia coli strain K-12 substr. MG1655 DDS in Escherichia coli strain K-12 substr. MG1655
     





FUNCTION: Can catalyze the hydrolysis of ATP in the presence of single-stranded DNA, the ATP-dependent uptake of single-stranded DNA by duplex DNA, and the ATP-dependent hybridization of homologous single-stranded DNAs. It interacts with lexA causing its activation and leading to its autocatalytic cleavage.

SUBCELLULAR LOCATION: Cytoplasm.

INDUCTION: In response to low temperature. Sensitive to temperature through changes in the linking number of the DNA.

SIMILARITY: Belongs to the recA family.


NCBI GenPept GI number(s): 37362719
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A7G6 P0A7G6
PFAM: - P0A7G6 (Link - using uniprot id)
InterPro: - P0A7G6 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
ARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKA
EIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMF
GNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAA
PFKQAEFQILYGEGINFYG

References:

Title Authors Journal
Organization of the recA gene of Escherichia coli. Horii T, Ogawa T, Ogawa H Proc Natl Acad Sci U S A Feb. 1, 1980
Sequences of the recA gene and protein. Sancar A, Stachelek C, Konigsberg W, Rupp WD Proc Natl Acad Sci U S A May 1, 1980
DNA sequence analysis of the recA genes from Proteus vulgaris, Erwinia carotovora, Shigella flexneri and Escherichia coli B/r. Zhao XJ, McEntee K Mol Gen Genet July 1, 1990
The structure of the E. coli recA protein monomer and polymer. Story RM, Weber IT, Steitz TA Nature Feb. 23, 1992
Structure of the recA protein-ADP complex. Story RM, Steitz TA Nature Feb. 23, 1992
The DNA-binding site of the RecA protein. Photochemical cross-linking of Tyr103 to single-stranded DNA. Morimatsu K, Horii T Eur J Biochem March 15, 1995
The identification of the single-stranded DNA-binding domain of the Escherichia coli RecA protein. Gardner RV, Voloshin ON, Camerini-Otero RD Eur J Biochem Oct. 15, 1995
The RecA hexamer is a structural homologue of ring helicases. Yu X, Egelman EH Nat Struct Biol Jan. 1, 1997
Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features. Yamamoto Y, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kimura S, Kitagawa M, Makino K, Miki T, Mitsuhashi N, Mizobuchi K, Mori H, Nakade S, Nakamura Y, Nashimoto H, Oshima T, Oyama S, Saito N, Sampei G, Satoh Y, Sivasundaram S, Tagami H, Horiuchi T, et al. DNA Res April 28, 1997
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.