Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RecE

Protein FULL name:

recE [Escherichia coli].


RecE (Escherichia coli strain K-12 substr. MG1655) is product of expression of recE gene.






FUNCTION: Is involved in the recE pathway of recombination. Has a strong preference for linear duplex substrate DNA and appears to be unable to initiate degradation from single-stranded breaks in DNA.

CATALYTIC ACTIVITY: Degradation of double-stranded DNA. It acts progressively in a 5' to 3' direction, releasing 5'- phosphomononucleotides.

SUBUNIT: Homotetramer.


NCBI GenPept GI number(s): 147536
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P15032 P15032
PFAM: - P15032 (Link - using uniprot id)
InterPro: - P15032 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSTKPLFLLRKAKKSSGEPDVVLWASNDFESTCATLDYLIVKSGKKLSSY
FKAVATNFPVVNDLPAEGEIDFTWSERYQLSKDSMTWELKPGAAPDNAHY
QGNTNVNGEDMTEIEENMLLPISGQELPIRWLAQHGSEKPVTHVSRDGLQ
ALHIARAEELPAVTALAVSHKTSLLDPLEIRELHKLVRDTDKVFPNPGNS
NLGLITAFFEAYLNADYTDRGLLTKEWMKGNRVSHITRTASGANAGGGNL
TDRGEGFVHDLTSLARDVATGVLARSMDLDIYNLHPAHAKRIEEIIAENK
PPFSVFRDKFITMPGGLDYSRAIVVASVKEAPIGIEVIPAHVTEYLNKVL
TETDHANPDPEIVDIGCGRSSAPMPQRVTEEGKQDDEEKPQPSGTTAVEQ
GEAETMEPDATEHHQDTQPLDAQSQVNSVDAKYQELRAELHEARKNIPSK
NPVDDDKLLAASRGEFVDGISDPNDPKWVKGIQTRDCVYQNQPETEKTSP
DMNQPEPVVQQEPEIACNACGQTGGDNCPDCGAVMGDATYQETFDEESQV
EAKENDPEEMEGAEHPHNENAGSDPHRDCSDETGEVADPVIVEDIEPGIY
YGISNENYHAGPGISKSQLDDIADTPALYLWRKNAPVDTTKTKTLDLGTA
FHCRVLEPEEF

References:

Title Authors Journal
Suppression of a frameshift mutation in the recE gene of Escherichia coli K-12 occurs by gene fusion. Chu CC, Templin A, Clark AJ J Bacteriol April 1, 1989
Physical analysis of spontaneous and mutagen-induced mutants of Escherichia coli K-12 expressing DNA exonuclease VIII activity. Mahajan SK, Chu CC, Willis DK, Templin A, Clark AJ Genetics June 1, 1990
Genetic and molecular analyses of the C-terminal region of the recE gene from the Rac prophage of Escherichia coli K-12 reveal the recT gene. Clark AJ, Sharma V, Brenowitz S, Chu CC, Sandler S, Satin L, Templin A, Berger I, Cohen A J Bacteriol Dec. 1, 1993
A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map. Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kasai H, Kashimoto K, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Horiuchi T, et al. DNA Res Dec. 31, 1996
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.