Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RecF |
Protein FULL name:
RecF [Escherichia coli].
RecF (Escherichia coli strain K-12 substr. MG1655) is product of expression of recF gene.
RecF is involved in:
HRR in Escherichia coli strain K-12 substr. MG1655
- RecA and RecFOR join and start the filament formation in Escherichia coli strain K-12 substr. MG1655
FUNCTION: The recF protein is involved in DNA metabolism; it is required for DNA replication and normal SOS inducibility. RecF binds preferentially to single-stranded, linear DNA. It also seems to bind ATP.
INTERACTION: P0A6F5:groL; NbExp=1; IntAct=EBI-556839, EBI-543750;
SUBCELLULAR LOCATION: Cytoplasm (By similarity).
SIMILARITY: Belongs to the recF family.
| NCBI GenPept GI number(s): |
147539 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0A7H0 |
P0A7H0 |
| PFAM: | - |
P0A7H0 (Link - using uniprot id) |
| InterPro: | - |
P0A7H0 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGR AFRSLQIGRVIRHEQEAFVLHGRLQGEERETAIGLTKDKQGDSKVRIDGT DGHKVAELAHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHNEPGFFTA WSNLKRLLKQRNAALRQVTRYEQLRPWDKELIPLAEQISTWRAEYSAGIA ADMADTCKQFLPEFSLTFSFQRGWEKETEYAEVLERNFERDRQLTYTAHG PHKADLRIRADGAPVEDTLSRGQLKLLMCALRLAQGEFLTRESGRRCLYL IDDFASELDDERRGLLASRLKATQSQVFVSAISAEHVIDMSDENSKMFTV EKGKITD |
References:
| Title | Authors | Journal |
| Molecular analysis of the recF gene of Escherichia coli. | Blanar MA, Sandler SJ, Armengod ME, Ream LW, Clark AJ | Proc Natl Acad Sci U S A Aug. 1, 1984 |
| DNA sequence and transcription of the region upstream of the E. coli gyrB gene. | Adachi T, Mizuuchi K, Menzel R, Gellert M | Nucleic Acids Res Aug. 24, 1984 |
| Purification and preliminary characterization of the Escherichia coli K-12 recF protein. | Griffin TJ 4th, Kolodner RD | J Bacteriol Nov. 1, 1990 |
| Sequence and complementation analysis of recF genes from Escherichia coli, Salmonella typhimurium, Pseudomonas putida and Bacillus subtilis: evidence for an essential phosphate binding loop. | Sandler SJ, Chackerian B, Li JT, Clark AJ | Nucleic Acids Res Jan. 25, 1992 |
| DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication. | Burland V, Plunkett G 3rd, Daniels DL, Blattner FR | Genomics June 1, 1993 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|