Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RecG

Protein FULL name:

recG [Escherichia coli].


RecG (Escherichia coli strain K-12 substr. MG1655) is product of expression of recG gene.


RecG is involved in:

HRR in Escherichia coli strain K-12 substr. MG1655




FUNCTION: Critical role in recombination and DNA repair. Help process Holliday junction intermediates to mature products by catalyzing branch migration. Has a DNA unwinding activity characteristic of a DNA helicase with a 3' to 5' polarity. recG unwind branched duplex DNA (Y-DNA). Has a role in constitutive stable DNA replication (csdR) and R-loop formation.

CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.

INTERACTION: P06959:aceF; NbExp=1; IntAct=EBI-556882, EBI-542707;

SIMILARITY: Belongs to the helicase family. RecG subfamily.

SIMILARITY: Contains 1 helicase ATP-binding domain.

SIMILARITY: Contains 1 helicase C-terminal domain.


NCBI GenPept GI number(s): 42669
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P24230 P24230
PFAM: - P24230 (Link - using uniprot id)
InterPro: IPR001650
IPR004365
IPR004609
IPR008994
IPR011545
IPR001650
IPR004365
IPR004609
IPR008994
IPR011545
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MKGRLLDAVPLSSLTGVGAALSNKLAKINLHTVQDLLLHLPLRYEDRTHL
YPIGELLPGVYATVEGEVLNCNISFGGRRMMTCQISDGSGILTMRFFNFS
AAMKNSLAAGRRVLAYGEAKRGKYGAEMIHPEYRVQGDLSTPELQETLTP
VYPTTEGVKQATLRKLTDQALDLLDTCAIEELLPPELSQGMMTLPEALRT
LHRPPPTLQLSDLETGQHPAQRRLILEELLAHNLSMLALRAGAQRFHAQP
LSANDTLKNKLLAALPFKPTGAQARVVAEIERDMALDVPMMRLVQGDVGS
GKTLVAALAALRAIAHGKQVALMAPTELLAEQHANNFRNWFAPLGIEVGW
LAGKQKGKARLAQQEAIASGQVQMIVGTHAIFQEQVQFNGLALVIIDEQH
RFGVHQRLALWEKGQQQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDE
LPPGRTPVTTVAIPDTRRTDIIDRVHHACITEGRQAYWVCTLIEESELLE
AQAAEATWEELKLALPELNVGLVHGRMKPAEKQAVMASFKQGELHLLVAT
TVIEVGVDVPNASLMIIENPERLGLAQLHQLRGRVGRGAVASHCVLLYKT
PLSKTAQIRLQVLRDSNDGFVIAQKDLEIRGPGELLGTRQTGNAEFKVAD
LLRDQAMIPEVQRLARHIHERYPQQAKALIERWMPETERYSNA

References:

Title Authors Journal
Molecular organization and nucleotide sequence of the recG locus of Escherichia coli K-12. Lloyd RG, Sharples GJ J Bacteriol Nov. 1, 1991
The nucleotide sequence of recG, the distal spo operon gene in Escherichia coli K-12. Kalman M, Murphy H, Cashel M Gene Feb. 2, 1992
DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication. Burland V, Plunkett G 3rd, Daniels DL, Blattner FR Genomics June 1, 1993
Branch migration of Holliday junctions: identification of RecG protein as a junction specific DNA helicase. Whitby MC, Vincent SD, Lloyd RG EMBO J Nov. 1, 1994
Escherichia coli RecG and RecA proteins in R-loop formation. Hong X, Cadwell GW, Kogoma T EMBO J May 15, 1995
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
radC102 of Escherichia coli is an allele of recG. Lombardo MJ, Rosenberg SM J Bacteriol Nov. 1, 2000
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.