Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RecN

Protein FULL name:

unnamed protein product [Escherichia coli].


RecN (Escherichia coli strain K-12 substr. MG1655) is product of expression of recN gene.


RecN is involved in:

DDS in Escherichia coli strain K-12 substr. MG1655
     





FUNCTION: May be involved in recombinational repair of damaged DNA.

INTERACTION: P76104:ydcP; NbExp=1; IntAct=EBI-548098, EBI-556974;

SIMILARITY: Belongs to the recN family.


NCBI GenPept GI number(s): 42693
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P05824 P05824
PFAM: - P05824 (Link - using uniprot id)
InterPro: - P05824 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MLAQLTISNFAIVRELEIDFHSGMTVITGETGAGKSIAIDALGLCLGGRA
EADMVRTGCRADLCARFSLKDTPARLRWLEENQLEDGHECLLRRVISSDG
RSRGFINGTAVPLSQLRELGQLLIQIHGQHAHQLLTKPEHQKFLLDGYAN
ETSLLQEMTARYQLWHQSCRDLAHHQQLSQERAARAELLQYQLKELNEFN
PQPGEFEQIDEEYKRLANSGQLLTTSQNALALMADGEDANLQSQLYTAKQ
LVSELIGMDSKLSGVLDMLEEATIQIAEASDELRHYCDRLDLDPNRLFEL
EQRISKQISLARKHHVSPEALPQYYQSLLEEQQQLDDQADSQETLALAVT
KHHQQALEIARALHQQRQQYAEELAQLITDSMHALSMPHGQFTIDVKFDE
HHLGADGADRIEFRVTTNPGQPMQPIAKVASGGELSRIALAIQVITARKM
ETPALIFDEVDVGISGPTAAVVGKLLRQLGESTQVMCVTHLPQVAGCGHQ
HYFVSKETDGAMTETHMQSLNKKARLQELARLLVAVKSHVIHWRMRKNCL
QRKLFSCFTVRVNSKTP

References:

Title Authors Journal
Nucleotide sequence and LexA regulation of the Escherichia coli recN gene. Rostas K, Morton SJ, Picksley SM, Lloyd RG Nucleic Acids Res July 10, 1987
Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features. Yamamoto Y, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kimura S, Kitagawa M, Makino K, Miki T, Mitsuhashi N, Mizobuchi K, Mori H, Nakade S, Nakamura Y, Nashimoto H, Oshima T, Oyama S, Saito N, Sampei G, Satoh Y, Sivasundaram S, Tagami H, Horiuchi T, et al. DNA Res April 28, 1997
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006
Escherichia coli K-12: a cooperatively developed annotation snapshot--2005. Riley M, Abe T, Arnaud MB, Berlyn MK, Blattner FR, Chaudhuri RR, Glasner JD, Horiuchi T, Keseler IM, Kosuge T, Mori H, Perna NT, Plunkett G 3rd, Rudd KE, Serres MH, Thomas GH, Thomson NR, Wishart D, Wanner BL Nucleic Acids Res Jan. 1, 2006


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.