Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RecO

Protein FULL name:

recO [Escherichia coli].


RecO (Escherichia coli strain K-12 substr. MG1655) is product of expression of recO gene.


RecO is involved in:

HRR in Escherichia coli strain K-12 substr. MG1655




FUNCTION: Involved in DNA repair and recF pathway recombination.

SUBUNIT: Monomer.

SIMILARITY: Belongs to the recO family.


NCBI GenPept GI number(s): 499369
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A7H3 P0A7H3
PFAM: - P0A7H3 (Link - using uniprot id)
InterPro: - P0A7H3 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGAL
QPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVL
EYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTH
CAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDAD
TLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTHYE

References:

Title Authors Journal
Genetic analysis of the rnc operon of Escherichia coli. Takiff HE, Chen SM, Court DL J Bacteriol May 1, 1989
Molecular analysis of the Escherichia coli recO gene. Morrison PT, Lovett ST, Gilson LE, Kolodner R J Bacteriol July 1, 1989
Suppression of insertions in the complex pdxJ operon of Escherichia coli K-12 by lon and other mutations. Lam HM, Tancula E, Dempsey WB, Winkler ME J Bacteriol March 1, 1992
Purification and characterization of the Escherichia coli RecO protein. Renaturation of complementary single-stranded DNA molecules catalyzed by the RecO protein. Luisi-DeLuca C, Kolodner R J Mol Biol Jan. 11, 1994
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.