Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RecT |
Protein FULL name:
unknown [Escherichia coli].
RecT (Escherichia coli strain K-12 substr. MG1655) is product of expression of recT gene.
FUNCTION: Binds to single-stranded DNA and also promotes the renaturation of complementary single-stranded DNA. Function in recombination. Has a function similar to that of lambda redB.
SUBUNIT: Homotetramer.
| NCBI GenPept GI number(s): |
397681 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P33228 |
P33228 |
| PFAM: | - |
P33228 (Link - using uniprot id) |
| InterPro: | - |
P33228 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MTKQPPIAKADLQKTQGNRAPAAVKNSDVISFINQPSMKEQLAAALPRHM TAERMIRIATTEIRKVPALGNCDTMSFVSAIVQCSQLGLEPGSALGHAYL LPFGNKNEKSGKKNVQLIIGYRGMIDLARRSGQIASLSARVVREGDEFSF EFGLDEKLIHRPGENEDAPVTHVYAVARLKDGGTQFEVMTRKQIELVRSL SKAGNNGPWVTHWEEMAKKTAIRRLFKYLPVSIEIQRAVSMDEKEPLTID PADSSVLTGEYSVIDNSEE |
References:
| Title | Authors | Journal |
| Identification and characterization of the Escherichia coli RecT protein, a protein encoded by the recE region that promotes renaturation of homologous single-stranded DNA. | Hall SD, Kane MF, Kolodner RD | J Bacteriol Feb. 1, 1993 |
| Genetic and molecular analyses of the C-terminal region of the recE gene from the Rac prophage of Escherichia coli K-12 reveal the recT gene. | Clark AJ, Sharma V, Brenowitz S, Chu CC, Sandler S, Satin L, Templin A, Berger I, Cohen A | J Bacteriol Dec. 1, 1993 |
| A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map. | Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kasai H, Kashimoto K, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Horiuchi T, et al. | DNA Res Dec. 31, 1996 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|