Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Rpa1p

Rpa1p (Saccharomyces cerevisiae) is product of expression of RPA190 gene.


Rpa1p is involved in:

MMR in Saccharomyces cerevisiae HRR in Saccharomyces cerevisiae NER in Saccharomyces cerevisiae




FUNCTION: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic core component of RNA polymerase I which synthesizes ribosomal RNA precursors. Forms the polymerase active center together with the second largest subunit. A single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol I. A bridging helix emanates from RPA1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol I by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition (By similarity).

CATALYTIC ACTIVITY: Nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1).

SUBUNIT: Component of the RNA polymerase I (Pol I) complex consisting of 14 subunits.

INTERACTION: P28007:GAR1; NbExp=1; IntAct=EBI-15730, EBI-7321; P22138:RPA2; NbExp=1; IntAct=EBI-15730, EBI-15736; P07703:RPC40; NbExp=1; IntAct=EBI-15730, EBI-15831; P20435:RPO26; NbExp=1; IntAct=EBI-15730, EBI-15786;

SUBCELLULAR LOCATION: Nucleus, nucleolus.

MISCELLANEOUS: Present with 2840 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the RNA polymerase beta' chain family.


NCBI GenPept GI number(s): 88191850
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P10964 P10964
PFAM: - P10964 (Link - using uniprot id)
InterPro: - P10964 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: 1YNX 1YNX


Protein sequence:
TRPIFAIEQLSPYQNVWTIKARVSYKGEIKTWHNQRGDGKLFNVNFLDTS
GEIRATAFNDFATKFNEILQEGKVYYVSKAKLQPAKPQFTNLTHPYELNL
DRDTVIEECFDESN

Rpa1p (Saccharomyces cerevisiae) is able to recognize following damages:
Solved crystal structures:
References:

Title Authors Journal
RPA190, the gene coding for the largest subunit of yeast RNA polymerase A. Memet S, Gouy M, Marck C, Sentenac A, Buhler JM J Biol Chem Jan. 25, 1988
Nucleotide sequence analysis of a 40 kb segment on the right arm of yeast chromosome XV reveals 18 open reading frames including a new pyruvate kinase and three homologues to chromosome I genes. Purnelle B, Goffeau A Yeast Nov. 1, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. Nature May 1, 1997
Differential roles of phosphorylation in the formation of transcriptional active RNA polymerase I. Fath S, Milkereit P, Peyroche G, Riva M, Carles C, Tschochner H Proc Natl Acad Sci U S A Dec. 4, 2001
Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae. Ficarro SB, McCleland ML, Stukenberg PT, Burke DJ, Ross MM, Shabanowitz J, Hunt DF, White FM Nat Biotechnol March 1, 2002
Rpa12p, a conserved RNA polymerase I subunit with two functional domains. Van Mullem V, Landrieux E, Vandenhaute J, Thuriaux P Mol Microbiol March 1, 2002
Localization of the yeast RNA polymerase I-specific subunits. Bischler N, Brino L, Carles C, Riva M, Tschochner H, Mallouh V, Schultz P EMBO J Aug. 1, 2002
The A14-A43 heterodimer subunit in yeast RNA pol I and their relationship to Rpb4-Rpb7 pol II subunits. Peyroche G, Levillain E, Siaut M, Callebaut I, Schultz P, Sentenac A, Riva M, Carles C Proc Natl Acad Sci U S A Nov. 12, 2002
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature Oct. 16, 2003
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics July 1, 2008


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.