Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RuvA

Protein FULL name:

unnamed protein product [Escherichia coli].


RuvA (Escherichia coli strain K-12 substr. MG1655) is product of expression of ruvA gene.


RuvA is involved in:

HRR in Escherichia coli strain K-12 substr. MG1655 DDS in Escherichia coli strain K-12 substr. MG1655
     





FUNCTION: The ruvA-ruvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may promote strand exchange reactions in homologous recombination. RuvAB is an helicase that mediates the Holliday junction migration by localized denaturation and reannealing. RuvA stimulates, in the presence of DNA, the weak ATPase activity of ruvB. Binds both single- and double-stranded DNA (dsDNA). Binds preferentially to supercoiled rather than to relaxed dsDNA.

CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.

SUBUNIT: Homotetramer; forms a complex with ruvB.

INDUCTION: Expression of the ruv region is induced by damage to DNA and is regulated by lexA as part of the SOS response. RuvA and ruvB are also involved in mutagenesis induced by UV and X irradiation and by some chemicals.

SIMILARITY: Belongs to the ruvA family.


NCBI GenPept GI number(s): 581226
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A809 P0A809
PFAM: - P0A809 (Link - using uniprot id)
InterPro: IPR000085
IPR003583
IPR011114
IPR012340
IPR013849
IPR000085
IPR003583
IPR011114
IPR012340
IPR013849
CATH: - -
SCOP: - -
PDB: 1BDX 1C7Y 1CUK 1D8L 1HJP 1BDX
1C7Y
1CUK
1D8L
1HJP


Protein sequence:
MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTH
FVVREDAQLLYGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVN
AVEREEVGALVKLPGIGKKTAERLIVEMKDRFKGLHGDLFTPAADLVLTS
PASPATDDAEQEAVARLVALGYKPQEASRMVSKIARPDASSETLIREALR
AAL

Solved crystal structures:
References:

Title Authors Journal
Nucleotide sequencing of the ruv region of Escherichia coli K-12 reveals a LexA regulated operon encoding two genes. Benson FE, Illing GT, Sharples GJ, Lloyd RG Nucleic Acids Res Jan. 25, 1988
Structure and regulation of the Escherichia coli ruv operon involved in DNA repair and recombination. Shinagawa H, Makino K, Amemura M, Kimura S, Iwasaki H, Nakata A J Bacteriol Sept. 1, 1988
Molecular analysis of the Escherichia coli ruvC gene, which encodes a Holliday junction-specific endonuclease. Takahagi M, Iwasaki H, Nakata A, Shinagawa H J Bacteriol Sept. 1, 1991
RuvA and RuvB proteins of Escherichia coli exhibit DNA helicase activity in vitro. Tsaneva IR, Muller B, West SC Proc Natl Acad Sci U S A Jan. 15, 1993
Crystal structure of DNA recombination protein RuvA and a model for its binding to the Holliday junction. Rafferty JB, Sedelnikova SE, Hargreaves D, Artymiuk PJ, Baker PJ, Sharples GJ, Mahdi AA, Lloyd RG, Rice DW Science Oct. 18, 1996
A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map. Itoh T, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Kasai H, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Seki Y, Horiuchi T, et al. DNA Res Dec. 31, 1996
Processing of recombination intermediates by the RuvABC proteins. West SC Annu Rev Genet Jan. 1, 1997
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Functional analyses of the domain structure in the Holliday junction binding protein RuvA. Nishino T, Ariyoshi M, Iwasaki H, Shinagawa H, Morikawa K Structure Feb. 15, 1998
Crystal structure of E.coli RuvA with bound DNA Holliday junction at 6 A resolution. Hargreaves D, Rice DW, Sedelnikova SE, Artymiuk PJ, Lloyd RG, Rafferty JB Nat Struct Biol June 1, 1998
Modulation of RuvB function by the mobile domain III of the Holliday junction recognition protein RuvA. Nishino T, Iwasaki H, Kataoka M, Ariyoshi M, Fujita T, Shinagawa H, Morikawa K J Mol Biol May 5, 2000
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.