Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RuvB

Protein FULL name:

unnamed protein product [Escherichia coli].


RuvB (Escherichia coli strain K-12 substr. MG1655) is product of expression of ruvB gene.


RuvB is involved in:

HRR in Escherichia coli strain K-12 substr. MG1655 DDS in Escherichia coli strain K-12 substr. MG1655
     





FUNCTION: The ruvA-ruvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may promote strand exchange reactions in homologous recombination. RuvAB is an helicase that mediates the Holliday junction migration by localized denaturation and reannealing.

CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.

ENZYME REGULATION: RuvB possesses weak ATPase activity, which is stimulated by the ruvA protein in the presence of DNA.

SUBUNIT: Homododecamer composed of two hexameric rings; when bound to DNA in the presence of ATP and magnesium. Forms a complex with ruvA.

INDUCTION: Expression of the ruv region is induced by damage to DNA and is regulated by lexA as part of the SOS response. RuvA and ruvB are also involved in mutagenesis induced by UV and X irradiation and by some chemicals.

SIMILARITY: Belongs to the ruvB family.


NCBI GenPept GI number(s): 42903
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A812 P0A812
PFAM: - P0A812 (Link - using uniprot id)
InterPro: IPR001984
IPR003593
IPR003959
IPR004605
IPR008823
IPR008824
IPR011991
IPR001984
IPR003593
IPR003959
IPR004605
IPR008823
IPR008824
IPR011991
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFIKAAKL
RGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAM
LTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKI
DLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFM
GLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQA
LDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDV
LEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP

References:

Title Authors Journal
Nucleotide sequencing of the ruv region of Escherichia coli K-12 reveals a LexA regulated operon encoding two genes. Benson FE, Illing GT, Sharples GJ, Lloyd RG Nucleic Acids Res Jan. 25, 1988
Structure and regulation of the Escherichia coli ruv operon involved in DNA repair and recombination. Shinagawa H, Makino K, Amemura M, Kimura S, Iwasaki H, Nakata A J Bacteriol Sept. 1, 1988
RuvA and RuvB proteins of Escherichia coli exhibit DNA helicase activity in vitro. Tsaneva IR, Muller B, West SC Proc Natl Acad Sci U S A Jan. 15, 1993
A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map. Itoh T, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Kasai H, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Seki Y, Horiuchi T, et al. DNA Res Dec. 31, 1996
Processing of recombination intermediates by the RuvABC proteins. West SC Annu Rev Genet Jan. 1, 1997
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.