Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RuvC

Protein FULL name:

ruvC [Escherichia coli].


RuvC (Escherichia coli strain K-12 substr. MG1655) is product of expression of ruvC gene.


RuvC is involved in:

HRR in Escherichia coli strain K-12 substr. MG1655




FUNCTION: Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group.

CATALYTIC ACTIVITY: Endonucleolytic cleavage at a junction such as a reciprocal single-stranded crossover between two homologous DNA duplexes (Holliday junction).

COFACTOR: Binds 1 magnesium ion per subunit.

SUBUNIT: Homodimer.

INTERACTION: P0A6F5:groL; NbExp=1; IntAct=EBI-1123014, EBI-543750;

SIMILARITY: Belongs to the ruvC family.


NCBI GenPept GI number(s): 42175
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A814 P0A814
PFAM: - P0A814 (Link - using uniprot id)
InterPro: IPR002176
IPR002176
CATH: - -
SCOP: - -
PDB: 1HJR 1HJR


Protein sequence:
MAIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYA
GVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVF
EYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITH
CHVSQNAMQMSESRLNLARGRLR

Solved crystal structures:
References:

Title Authors Journal
Formation and resolution of recombination intermediates by E. coli RecA and RuvC proteins. Dunderdale HJ, Benson FE, Parsons CA, Sharples GJ, Lloyd RG, West SC Nature Jan. 1, 1991
Molecular analysis of the Escherichia coli ruvC gene, which encodes a Holliday junction-specific endonuclease. Takahagi M, Iwasaki H, Nakata A, Shinagawa H J Bacteriol Sept. 1, 1991
Resolution of Holliday junctions in Escherichia coli: identification of the ruvC gene product as a 19-kilodalton protein. Sharples GJ, Lloyd RG J Bacteriol Dec. 1, 1991
Escherichia coli RuvC protein is an endonuclease that resolves the Holliday structure. Iwasaki H, Takahagi M, Shiba T, Nakata A, Shinagawa H EMBO J Dec. 1, 1991
Atomic structure of the RuvC resolvase: a holliday junction-specific endonuclease from E. coli. Ariyoshi M, Vassylyev DG, Iwasaki H, Nakamura H, Shinagawa H, Morikawa K Cell Sept. 23, 1994
A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map. Itoh T, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Kasai H, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Seki Y, Horiuchi T, et al. DNA Res Dec. 31, 1996
Processing of recombination intermediates by the RuvABC proteins. West SC Annu Rev Genet Jan. 1, 1997
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.