Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

SbcC

Protein FULL name:

unnamed protein product [Escherichia coli].


SbcC (Escherichia coli strain K-12 substr. MG1655) is product of expression of sbcC gene.


SbcC is involved in:

DDS in Escherichia coli strain K-12 substr. MG1655
     


Keywords:



FUNCTION: SbcCD cleaves DNA hairpin structures. These structures can inhibit DNA replication and are intermediates in certain DNA recombination reactions. The complex acts as a 3'->5' double strand exonuclease that can open hairpins. It also has a 5' single-strand endonuclease activity.

SUBUNIT: Heterodimer of sbcC and sbcD.

INTERACTION: P0A717:prs; NbExp=1; IntAct=EBI-546919, EBI-906827; P76092:ynbC; NbExp=1; IntAct=EBI-546919, EBI-544837;

SIMILARITY: Belongs to the SMC family. SbcC subfamily.


NCBI GenPept GI number(s): 42914
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P13458 P13458
PFAM: - P13458 (Link - using uniprot id)
InterPro: IPR003395
IPR003439
IPR004592
IPR003395
IPR003439
IPR004592
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MKILSLRLKNLNSLKGEWKIDFTREPFASNGLFAITGPTGAGKTTLLDAI
CLALYHETPRLSNVSQSQNDLMTRDTAECLAEVEFEVKGEAYRAFWSQNR
ARNQPDGNLQVPRVELARCADGKILADKVKDKLELTATLTGLDYGRFTRS
MLLSQGQFAAFLNAKPKERAELLEELTGTEIYGQISAMVFEQHKSARTEL
EKLQAQASGVTLLTPEQVQSLTASLQVLTDEEKQLITAQQQEQQSLNWLT
RQDELQQEASRRQQALQQALAEEEKAQPQLAALSLAQPARNLRPHWERIA
EHSAALAHIRQQIEEVNTRLQSTMALRASIRHHAAKQSAELQQQQQSLNT
WLQEHDRFRQWNNEPAGWRAQFSQQTSDREHLRQWQQQLTHAEQKLNALA
AITLTLTADEVATALAQHAEQRPLRQHLVALHGQIVPQQKRLAQLQVAIQ
NVTQEQTQRNAALNEMRQRYKEKTQQLADVKTICEQEARIKTLEAQRAQL
QAGQPCPLCGSTSHPAVEAYQALEPGVNQSRLLALENEVKKLGEEGATLR
GQLDAITKQLQRDENEAQSLRQDEQALTQQWQAVTASLNITLQPLDDIQP
WLDAQDEHERQLRLLSQRHELQGQIAAHNQQIIQYQQQIEQRQQLLLTTL
TGYALTLPQEDEEESWLATRQQEAQSWQQRQNELTALQNRIQQLTPILET
LPQSDELPHCEETVVLENWRQVHEQCLALHSQQQTLQQQDVLAAQSLQKA
QAQFDTALQASVFDDQQAFLAALMDEQTLTQLEQLKQNLENQRRQAQTLV
TQTAETLAQHQQHRPDDGLALTVTVEQIQQELAQTHQKLRENTTSQGEIR
QQLKQDADNRQQQQTLMQQIAQMTQQVEDWGYLNSLIGSKEGDKFRKFAQ
GLTLDNLVHLANQQLTRLHGRYLLQRKASEALEVEVVDTWQADAVRDTRT
LSGGESFLVSLALALALSDLVSHKTRIDSLFLDEGFGTLDSETLDTALDA
LDALNASGKTIGVISHVEAMKERIPVQIKVKKINGLGYSKLESTFAVK

References:

Title Authors Journal
Molecular organization of sbcC, a gene that affects genetic recombination and the viability of DNA palindromes in Escherichia coli K-12. Naom IS, Morton SJ, Leach DR, Lloyd RG Nucleic Acids Res Oct. 25, 1989
Mapping, sequence, and apparent lack of function of araJ, a gene of the Escherichia coli arabinose regulon. Reeder T, Schleif R J Bacteriol Dec. 1, 1991
The SbcCD protein of Escherichia coli is related to two putative nucleases in the UvrA superfamily of nucleotide-binding proteins. Leach DR, Lloyd RG, Coulson AF Genetica Jan. 1, 1992
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
The SbcCD nuclease of Escherichia coli is a structural maintenance of chromosomes (SMC) family protein that cleaves hairpin DNA. Connelly JC, Kirkham LA, Leach DR Proc Natl Acad Sci U S A July 7, 1998
DNA cleavage and degradation by the SbcCD protein complex from Escherichia coli. Connelly JC, de Leau ES, Leach DR Nucleic Acids Res Jan. 15, 1999
Genes involved in the determination of the rate of inversions at short inverted repeats. Slupska MM, Chiang JH, Luther WM, Stewart JL, Amii L, Conrad A, Miller JH Genes Cells June 1, 2000
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.