Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

HelD

Protein FULL name:

helicase IV [Escherichia coli].


HelD (Escherichia coli strain K-12 substr. MG1655) is product of expression of helD gene.






FUNCTION: Helicase IV catalyzes the unwinding of duplex DNA in the 3' to 5' direction with respect to the bound single strand in a reaction that is dependent upon the hydrolysis of ATP.

CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.

INTERACTION: P37095:pepB; NbExp=1; IntAct=EBI-551473, EBI-549539; P0A6N1:tufA; NbExp=1; IntAct=EBI-551473, EBI-301077;

SIMILARITY: Belongs to the helicase family. UvrD subfamily.

SIMILARITY: Contains 1 uvrD-like helicase ATP-binding domain.


NCBI GenPept GI number(s): 146328
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P15038 P15038
PFAM: - P15038 (Link - using uniprot id)
InterPro: - P15038 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MELKATTLGKRLAQHPYDRAVILNAGIKVSGDRHEYLIPFNQLLAIHCKR
GLVWGELEFVLPDEKVVRLPGTEWGETQRFYHHLDAHWRRWSGEMSEIAS
GVLRQQLDLIATRTGENKWLTREQTSGVQQQIRQALLRVALPVNRLEEFD
NCREAWRKCQAWLKDIESARLQHNQAYTEAMLTEYADFFRQVESSPLNPA
QARAVVNGEHSLLVLAGAGSGKTSVLVARAGWLLARGEASPEQILLLAFG
RKAAEEMDERIRERLHTEDITARTFHALALHIIQQGSKKVPIVSKLENDT
AARHELFIAEWRKQCSEKKAQAKGWRQWLTEEMQWSVPEGNFWDDEKLQR
RLASRLDRWVSLMRIDGGAQAEMIASAPEEIRDLFSKRIKLMAPLLKAWK
GALKAENAVDFSGLIHQAIVILEKGRFISPWKHILVDEFQDISPQRAALL
AALRKQNSQTTLFAVGDDWQAIYRFSGAQMSLTTAFHENFGEGERCDLDT
TYRFNSRIGEVANRFIQQNPGQLKKPLNSLTNGDKKAVTLLDESQLDALL
DKLSGYAKPEERILILARYHHMRPASLEKAATRWPKLQIDFMTIHASKGQ
QADYVIIVGLQEGSDGFPAAARESIMEEALLPPVEDFPDAEERRLMYVAL
TRARHRVWALFNKENPSPFVEILKNLDVPVARKP

References:

Title Authors Journal
The molecular cloning of the gene encoding the Escherichia coli 75-kDa helicase and the determination of its nucleotide sequence and gentic map position. Wood ER, Matson SW J Biol Chem May 15, 1989
A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al. DNA Res June 1, 1996
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.