Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ada

Protein FULL name:

Regulatory protein Ada, Regulatory protein of adaptative response, Contains: Methylated-DNA-protein-cysteine methyltransferase, O-6-methylguanine-DNA alkyltransferase.,


Ada (Escherichia coli strain K-12 substr. MG1655) is product of expression of ada gene.


Ada is involved in:

DRR in Escherichia coli strain K-12 substr. MG1655

Keywords:



FUNCTION: Repair of alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated. Can also repair O-4-methylthymine.

FUNCTION: The methylated ADA protein acts as a positive regulator of its own synthesis, as well as that of other proteins. The transcription-activating function of the ADA protein resides in its N-terminus. It activates the transcription of alkA, alkB and aidB.

CATALYTIC ACTIVITY: DNA (containing 6-O-methylguanine) + protein L-cysteine = DNA (without 6-O-methylguanine) + protein S-methyl-L- cysteine.

COFACTOR: Binds 1 zinc ion per subunit.

MISCELLANEOUS: This enzyme catalyzes only one turnover and therefore is not strictly catalytic. According to one definition, an enzyme is a biocytalyst that acts repeatedly and over many reaction cycles.

SIMILARITY: In the C-terminal section; belongs to the MGMT family.

SIMILARITY: Contains 1 HTH araC/xylS-type DNA-binding domain.


NCBI GenPept GI number(s): 461468
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P06134 P06134
PFAM: PF02805
PF01035
PF00165
PF02870
PF02805
PF01035
PF00165
PF02870
InterPro: IPR004026
IPR016221
IPR009057
IPR000005
IPR018062
IPR018060
IPR001497
IPR014048
IPR008332
IPR011991
IPR004026
IPR016221
IPR009057
IPR000005
IPR018062
IPR018060
IPR001497
IPR014048
IPR008332
IPR011991
CATH: None  
SCOP: None  
PDB: - -


Protein sequence:
MKKATCLTDDQRWQSVLARDPNADGEFVFAVRTTGIFCRPSCRARHALRE
NVSFYANASEALAAGFRPCKRCQPEKANAQQHRLDKITHACRLLEQETPV
TLEALADQVAMSPFHLHRLFKATTGMTPKAWQQAWRARRLRESLAKGESV
TTSILNAGFPDSSSYYRKADETLGMTAKQFRHGGENLAVRYALADCELGR
CLVAESERGICAILLGDDDATLISELQQMFPAADNAPADLMFQQHVREVI
ASLNQRDTPLTLPLDIRGTAFQQQVWQALRTIPCGETVSYQQLANAIGKP
KAVRAVASACAANKLAIIIPCHRVVRGDGTLSGYRWGVSRKAQLLRREAE
NEER

Ada (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:

Last modification of this entry: Nov. 11, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.