Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

AidB

Protein FULL name:

Protein AidB.


AidB (Escherichia coli strain K-12 substr. MG1655) is product of expression of aidB gene.


AidB is involved in:

DDS in Escherichia coli strain K-12 substr. MG1655
     


Keywords:


Upon exposure to alkylating agents, Escherichia coli increases expression of aidB along with three genes (ada, alkA, and alkB) that encode DNA repair proteins. While the biological roles of Ada, AlkA and AlkB proteins have been defined, despite many efforts, the molecular functions of AidB remain largely unknown. In this study, we focused on the biological role of the AidB protein and we demonstrated that AidB shows preferential binding to a DNA region that includes the upstream element of its own promoter, PaidB. The physiological significance of this specific interaction was investigated by in vivo gene expression assays demonstrating that AidB can repress its own synthesis during the normal cell growth. We also showed that the domain architecture of AidB is related to the different functions of the protein: the N-terminal region comprising the first 439 amino acids (AidB 'I-III') possesses FAD-dependent dehydrogenase activity while its C-terminal domain corresponding to residues 440-541 (AidB 'IV') displays DNA binding activity and can negatively regulate the expression of its own gene in vivo.


INDUCTION: By alkylating agents.

SIMILARITY: Belongs to the acyl-CoA dehydrogenase family.

SEQUENCE CAUTION: Sequence=AAA97083.1; Type=Erroneous initiation; Note=Translation N-terminally shortened; Sequence=AAC18889.1; Type=Erroneous initiation; Note=Translation N-terminally shortened;


NCBI GenPept GI number(s): 12644215
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P33224 P33224
PFAM: PF00441
PF02770
PF00441
PF02770
InterPro: IPR006089
IPR006090
IPR006091
IPR009075
IPR009100
IPR013764
IPR006089
IPR006090
IPR006091
IPR009075
IPR009100
IPR013764
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MHWQTHTVFNQPIPLNNSNLYLSDGALCEAVTREGAGWDSDFLASIGQQL
GTAESLELGRLANVNPPELLRYDAQGRRLDDVRFHPAWHLLMQALCTNRV
HNLAWEEDARSGAFVARAARFMLHAQVEAGSLCPITMTFAATPLLLQMLP
APFQDWTTPLLSDRYDSHLLPGGQKRGLLIGMGMTEKQGGSDVMSNTTRA
ERLEDGSYRLVGHKWFFSVPQSDAHLVLAQTAGGLSCFFVPRFLPDGQRN
AIRLERLKDKLGNRSNASCEVEFQDAIGWLLGLEGEGIRLILKMGGMTRF
DCALGSHAMMRRAFSLAIYHAHQRHVFGNPLIQQPLMRHVLSRMALQLEG
QTALLFRLARAWDRRADAKEALWARLFTPAAKFVICKRGMPFVAEAMEVL
GGIGYCEESELPRLYREMPVNSIWEGSGNIMCLDVLRVLNKQAGVYDLLS
EAFVEVKGQDRYFDRAVRRLQQQLRKPAEELGREITHQLFLLGCGAQMLK
YASPPMAQAWCQVMLDTRGGVRLSEQIQNDLLLRATGGVCV

AidB (Escherichia coli strain K-12 substr. MG1655) belongs to following protein families:
References:

Title Authors Journal
Structure and transcriptional regulation of the Escherichia coli adaptive response gene aidB. Landini P, Hajec LI, Volkert MR J Bacteriol Nov. 1, 1994
Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes. Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL, Blattner FR Nucleic Acids Res June 25, 1995
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 18, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.