Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

PMS6

Protein FULL name:

PMS6 [Homo sapiens].


PMS6 (Homo sapiens) is product of expression of PMS2L4 gene.





NCBI GenPept GI number(s): 1304123
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q16544 Q16544
PFAM: - Q16544 (Link - using uniprot id)
InterPro: - Q16544 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
RVLSPWSELRARGTEPAKAIKPIDRKSVHQICSGPVVLSLSTAVKELVEN
SLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTMSPFLPATHRR
RLGLDWCLITMGKSSRKPPTPTPEDHSQREAVISTLPVHHKEFQRNIKKT
CLFPLRLLP

References:

Title Authors Journal
Cloning, characterization and chromosomal assignment of the human genes homologous to yeast PMS1, a member of mismatch repair genes. Horii A, Han HJ, Sasaki S, Shimada M, Nakamura Y Biochem Biophys Res Commun Nov. 15, 1994


Last modification of this entry: Oct. 14, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.