Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RAD51L3 |
Protein FULL name:
RAD51-like 3 isoform 1 [Homo sapiens].
RAD51L3 (Homo sapiens) is product of expression of RAD51L3 gene.
FUNCTION: Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. The BCDX2 complex binds single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA.
SUBUNIT: Part of a BCDX2 complex consisting of RAD51B, RAD51C, RAD51D and XRCC2. Part of a complex consisting of RAD51B, RAD51C, RAD51D, XRCC2 and XRCC3. Interacts with ZSWIM7.
INTERACTION: P81605:DCD; NbExp=1; IntAct=EBI-1055693, EBI-395625; Q96JH8:RADIL; NbExp=1; IntAct=EBI-1055693, EBI-744267;
SUBCELLULAR LOCATION: Nucleus (Probable).
TISSUE SPECIFICITY: Expressed in colon, prostate, spleen, testis, ovary, thymus and small intestine. Weakly expressed in leukocytes.
SIMILARITY: Belongs to the recA family. RAD51 subfamily.
WEB RESOURCE: Name=NIEHS-SNPs; [LINK]
| NCBI GenPept GI number(s): |
19924119 |
| Species: | Homo sapiens |
Links to other databases:
| Database | ID | Link |
| Uniprot | O75771 |
O75771 |
| PFAM: | - |
O75771 (Link - using uniprot id) |
| InterPro: | - |
O75771 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKAL VALRRVLLAQFSAFPVNGADLHEELKTSTAILSTGIGSLDKLLDAGLYTG EVTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGGLTASRLLQLL QAKTQDEEEQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTV KVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNH ITRDRDSGRLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSR QPTGFQEMVDIGTWGTSEQSATLQGDQT |
RAD51L3 (Homo sapiens) is able to recognize following damages:
RAD51L3 (Homo sapiens) belongs to following protein families:
References:
| Title | Authors | Journal |
| Isolation of novel human and mouse genes of the recA/RAD51 recombination-repair gene family. | Cartwright R, Dunn AM, Simpson PJ, Tambini CE, Thacker J | Nucleic Acids Res April 1, 1998 |
| Identification, characterization, and genetic mapping of Rad51d, a new mouse and human RAD51/RecA-related gene. | Pittman DL, Weinberg LR, Schimenti JC | Genomics April 1, 1998 |
| Multiple alternative transcripts of the human homologue of the mouse TRAD/R51H3/RAD51D gene, a member of the rec A/RAD51 gene family. | Kawabata M, Saeki K | Biochem Biophys Res Commun April 2, 1999 |
| Identification and purification of two distinct complexes containing the five RAD51 paralogs. | Masson JY, Tarsounas MC, Stasiak AZ, Stasiak A, Shah R, McIlwraith MJ, Benson FE, West SC | Genes Dev Dec. 15, 2001 |
| Involvement of Rad51C in two distinct protein complexes of Rad51 paralogs in human cells. | Liu N, Schild D, Thelen MP, Thompson LH | Nucleic Acids Res Jan. 15, 2002 |
| Interactions involving the Rad51 paralogs Rad51C and XRCC3 in human cells. | Wiese C, Collins DW, Albala JS, Thompson LH, Kronenberg A, Schild D | Nucleic Acids Res Jan. 15, 2002 |
| RAD51C interacts with RAD51B and is central to a larger protein complex in vivo exclusive of RAD51. | Miller KA, Yoshikawa DM, McConnell IR, Clark R, Schild D, Albala JS | J Biol Chem March 8, 2002 |
| An unappreciated role for RNA surveillance. | Hillman RT, Green RE, Brenner SE | Genome Biol Jan. 1, 2004 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
| Sws1 is a conserved regulator of homologous recombination in eukaryotic cells. | Martin V, Chahwan C, Gao H, Blais V, Wohlschlegel J, Yates JR 3rd, McGowan CH, Russell P | EMBO J June 7, 2006 |
| The full-ORF clone resource of the German cDNA Consortium. | Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I | BMC Genomics Jan. 1, 2007 |
Last modification of this entry: Oct. 11, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|