Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

PNKP

Protein FULL name:

bifunctional polynucleotide phosphatase/kinase [Homo sapiens].


PNKP (Homo sapiens) is product of expression of PNKP gene.


PNKP is involved in:

BER in Homo sapiens
     


Keywords:



FUNCTION: Catalyzes the phosphorylation of DNA at 5'-hydroxyl termini and can dephosphorylate its 3'-phosphate termini. Plays an important function in DNA repair following ionizing radiation or oxidative damage.

CATALYTIC ACTIVITY: A 3'-phosphopolynucleotide + H(2)O = a polynucleotide + phosphate.

CATALYTIC ACTIVITY: ATP + 5'-dephospho-DNA = ADP + 5'-phospho-DNA.

INTERACTION: Q9UHI6:DDX20; NbExp=1; IntAct=EBI-1045072, EBI-347658; Q86Y56:HEATR2; NbExp=1; IntAct=EBI-1045072, EBI-719966; Q9Y4W2:LAS1L; NbExp=1; IntAct=EBI-1045072, EBI-1051591; P49916:LIG3; NbExp=1; IntAct=EBI-1045072, EBI-1753381; P49917:LIG4; NbExp=1; IntAct=EBI-1045072, EBI-847896; P25205:MCM3; NbExp=1; IntAct=EBI-1045072, EBI-355153; O60936:NOL3; NbExp=1; IntAct=EBI-1045072, EBI-740992; Q8N1F7:NUP93; NbExp=1; IntAct=EBI-1045072, EBI-1042703; O75746:SLC25A12; NbExp=1; IntAct=EBI-1045072, EBI-1047585; P18887:XRCC1; NbExp=1; IntAct=EBI-1045072, EBI-947466; Q13426:XRCC4; NbExp=1; IntAct=EBI-1045072, EBI-717592; P27348:YWHAQ; NbExp=1; IntAct=EBI-1045072, EBI-359854;

SUBCELLULAR LOCATION: Nucleus.

TISSUE SPECIFICITY: Expressed in many tissues with highest expression in spleen and testis, and lowest expression in small intestine (PubMed:10446192). Expressed in higher amount in pancreas, heart and kidney and at lower levels in brain, lung and liver (PubMed:10446193).

PTM: Phosphorylated upon DNA damage, probably by ATM or ATR.

SIMILARITY: In the N-terminal section; belongs to the DNA 3' phosphatase family.

SEQUENCE CAUTION: Sequence=AAD47379.1; Type=Frameshift; Positions=Several;

WEB RESOURCE: Name=NIEHS-SNPs; [LINK]


NCBI GenPept GI number(s): 31543419
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q96T60 Q96T60
PFAM: - Q96T60 (Link - using uniprot id)
InterPro: - Q96T60 (Link - using uniprot id)
CATH: None  
SCOP: None  
PDB: - -


Protein sequence:
MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQ
VELVADPETRTVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYLVNGLH
PLTLRWEETRTPESQPDTPPGTPLVSQDEKRDAELPKKRMRKSNPGWENL
EKLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGPSDWRILYPEIP
RKLRELEAEGYKLVIFTNQMSIGRGKLPAEEFKAKVEAVVEKLGVPFQVL
VATHAGLYRKPVTGMWDHLQEQANDGTPISIGDSIFVGDAAGRPANWAPG
RKKKDFSCADRLFALNLGLPFATPEEFFLKWPAAGFELPAFDPRTVSRSG
PLCLPESRALLSASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLG
SWQRCVTTCETALKQGKRVAIDNTNPDAASRARYVQCARAAGVPCRCFLF
TATLEQARHNNRFREMTDSSHIPVSDMVMYGYRKQFEAPTLAEGFSAILE
IPFRLWVEPRLGRLYCQFSEG

PNKP (Homo sapiens) is able to recognize following damages:
PNKP (Homo sapiens) belongs to following protein families:
References:

Title Authors Journal
Molecular cloning of the human gene, PNKP, encoding a polynucleotide kinase 3'-phosphatase and evidence for its role in repair of DNA strand breaks caused by oxidative damage. Jilani A, Ramotar D, Slack C, Ong C, Yang XM, Scherer SW, Lasko DD J Biol Chem Aug. 20, 1999
Molecular characterization of a human DNA kinase. Karimi-Busheri F, Daly G, Robins P, Canas B, Pappin DJ, Sgouros J, Miller GG, Fakhrai H, Davis EM, Le Beau MM, Weinfeld M J Biol Chem Aug. 20, 1999
The DNA sequence and biology of human chromosome 19. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM Nature April 1, 2004
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J Genome Res Oct. 1, 2004
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M Cell Nov. 3, 2006
ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ Science May 25, 2007
A quantitative atlas of mitotic phosphorylation. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP Proc Natl Acad Sci U S A Aug. 5, 2008
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK Sci Signal Jan. 1, 2009
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S Anal Chem June 1, 2009


Last modification of this entry: Oct. 14, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.