Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

EME2

Protein FULL name:

probable crossover junction endonuclease EME2 [Homo sapiens].


EME2 (Homo sapiens) is product of expression of EME2 gene.


EME2 is involved in:

HRR in Homo sapiens
     


Keywords:



FUNCTION: Interacts with MUS81 to form a DNA structure-specific endonuclease which cleaves substrates such as 3'-flap structures.

SUBUNIT: Interacts with MUS81.

SUBCELLULAR LOCATION: Nucleus (Probable).

SIMILARITY: Belongs to the EME1/MMS4 family.

SEQUENCE CAUTION: Sequence=AAK61292.1; Type=Erroneous gene model prediction; Sequence=BAB84906.2; Type=Erroneous initiation;


NCBI GenPept GI number(s): 58197552
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot A4GXA9 A4GXA9
PFAM: - A4GXA9 (Link - using uniprot id)
InterPro: - A4GXA9 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MARVGPGRAGVSCQGRGRGRGGSGQRRPPTWEISDSDAEDSAGSEAAARA
RDPAGERRAAAEALRLLRPEQVLKRLAVCVDTAILEDAGADVLMEALEAL
GCECRIEPQRPARSLRWTRASPDPCPRSLPPEVWAAGEQELLLLLEPEEF
LQGVATLTQISGPTHWVPWISPETTARPHLAVIGLDAYLWYRSLSCPQQG
WLGRGFRGGGLWQRPSSGRAGPMGSGEEWSPLLRSRQHVSRGTQQPESPK
VAGAEVAVSWPEVEEVRACLSWALVLLQLWANLDVLLVASWQELSRHVCA
VTKALAQYPLKCVMPRLKGGRITSRQYRESQAFSFCTAGRWAAGEPVARD
GAGLQAAWRRQIRQFSRVSPAVADAVVTAFPSPRLLQQALEACSTERERM
GLLADLPVPPSEGGRPRRVGPDLSRRICLFLTTANPDLLLDLGS

EME2 (Homo sapiens) is able to recognize following damages:
EME2 (Homo sapiens) belongs to following protein families:
References:

Title Authors Journal
Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16. Daniels RJ, Peden JF, Lloyd C, Horsley SW, Clark K, Tufarelli C, Kearney L, Buckle VJ, Doggett NA, Flint J, Higgs DR Hum Mol Genet Jan. 15, 2001
Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones. Jikuya H, Takano J, Kikuno R, Hirosawa M, Nagase T, Nomura N, Ohara O DNA Res Jan. 28, 2003
Identification of FAAP24, a Fanconi anemia core complex protein that interacts with FANCM. Ciccia A, Ling C, Coulthard R, Yan Z, Xue Y, Meetei AR, Laghmani el H, Joenje H, McDonald N, de Winter JP, Wang W, West SC Mol Cell Jan. 9, 2007


Last modification of this entry: Oct. 12, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.