Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

BRCA2

Protein FULL name:

breast cancer type 2 susceptibility protein [Homo sapiens].


BRCA2 (Homo sapiens) is product of expression of BRCA2 gene.

Human diseases related to this protein:

BRCA2 is involved in:

HRR in Homo sapiens
     


Keywords:



FUNCTION: Involved in double-strand break repair and/or homologous recombination. May participate in S phase checkpoint activation.

SUBUNIT: Interacts with RAD51 and DSS1. Interacts with ubiquitinated FANCD2. Interacts with PALB2, enables the recombinational repair and checkpoints functions. Interacts with WDR16.

INTERACTION: P00519:ABL1; NbExp=1; IntAct=EBI-79792, EBI-375543; Q9BXW9:FANCD2; NbExp=9; IntAct=EBI-79792, EBI-359343; Q9BXW9-2:FANCD2; NbExp=2; IntAct=EBI-79792, EBI-596878; P06241:FYN; NbExp=1; IntAct=EBI-79792, EBI-515315; P62993:GRB2; NbExp=1; IntAct=EBI-79792, EBI-401755; Q06609:RAD51; NbExp=7; IntAct=EBI-79792, EBI-297202; P60896:SHFM1; NbExp=3; IntAct=EBI-79792, EBI-79819;

TISSUE SPECIFICITY: Highest levels of expression in breast and thymus, with slightly lower levels in lung, ovary and spleen.

PTM: Phosphorylated by ATM upon irradiation-induced DNA damage.

POLYMORPHISM: Genetic variations in BRCA2 may underlie susceptibility to uveal melanoma [MIM:155720]. Uveal melanoma is the most common type of ocular malignant tumor, consisting of overgrowth of uveal melanocytes and often preceded by a uveal nevus.

DISEASE: Defects in BRCA2 are a cause of susceptibility to breast cancer (BC) [MIM:114480]. A common malignancy originating from breast epithelial tissue. Breast neoplasms can be distinguished by their histologic pattern. Invasive ductal carcinoma is by far the most common type. Breast cancer is etiologically and genetically heterogeneous. Important genetic factors have been indicated by familial occurrence and bilateral involvement. Mutations at more than one locus can be involved in different families or even in the same case.

DISEASE: Defects in BRCA2 are a cause of susceptibility to breast- ovarian cancer familial type 2 (BROVCA2) [MIM:612555]. A condition associated with familial predisposition to cancer of the breast and ovaries. Characteristic features in affected families are an early age of onset of breast cancer (often before age 50), increased chance of bilateral cancers (cancer that develop in both breasts, or both ovaries, independently), frequent occurrence of breast cancer among men, increased incidence of tumors of other specific organs, such as the prostate.

DISEASE: Defects in BRCA2 are the cause of Fanconi anemia complementation group D type 1 (FANCD1) [MIM:605724]. Fanconi anemia (FA) [MIM:227650] is an autosomal recessive disorder affecting all bone marrow elements and associated with cardiac, renal and limb malformations as well as dermal pigmentary changes.

SIMILARITY: Contains 8 BRCA2 repeats.

WEB RESOURCE: Name=Fanconi Anemia Mutation Database; [LINK]

WEB RESOURCE: Name=GeneReviews; [LINK]

WEB RESOURCE: Name=NIEHS-SNPs; [LINK]

WEB RESOURCE: Name=Wikipedia; Note=BRCA2 entry; [LINK]


NCBI GenPept GI number(s): 119395734
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot P51587 P51587
PFAM: - P51587 (Link - using uniprot id)
InterPro: - P51587 (Link - using uniprot id)
CATH: None  
SCOP: None  
PDB: - -


Protein sequence:
MPIGSKERPTFFEIFKTRCNKADLGPISLNWFEELSSEAPPYNSEPAEES
EHKNNNYEPNLFKTPQRKPSYNQLASTPIIFKEQGLTLPLYQSPVKELDK
FKLDLGRNVPNSRHKSLRTVKTKMDQADDVSCPLLNSCLSESPVVLQCTH
VTPQRDKSVVCGSLFHTPKFVKGRQTPKHISESLGAEVDPDMSWSSSLAT
PPTLSSTVLIVRNEEASETVFPHDTTANVKSYFSNHDESLKKNDRFIASV
TDSENTNQREAASHGFGKTSGNSFKVNSCKDHIGKSMPNVLEDEVYETVV
DTSEEDSFSLCFSKCRTKNLQKVRTSKTRKKIFHEANADECEKSKNQVKE
KYSFVSEVEPNDTDPLDSNVANQKPFESGSDKISKEVVPSLACEWSQLTL
SGLNGAQMEKIPLLHISSCDQNISEKDLLDTENKRKKDFLTSENSLPRIS
SLPKSEKPLNEETVVNKRDEEQHLESHTDCILAVKQAISGTSPVASSFQG
IKKSIFRIRESPKETFNASFSGHMTDPNFKKETEASESGLEIHTVCSQKE
DSLCPNLIDNGSWPATTTQNSVALKNAGLISTLKKKTNKFIYAIHDETSY
KGKKIPKDQKSELINCSAQFEANAFEAPLTFANADSGLLHSSVKRSCSQN
DSEEPTLSLTSSFGTILRKCSRNETCSNNTVISQDLDYKEAKCNKEKLQL
FITPEADSLSCLQEGQCENDPKSKKVSDIKEEVLAAACHPVQHSKVEYSD
TDFQSQKSLLYDHENASTLILTPTSKDVLSNLVMISRGKESYKMSDKLKG
NNYESDVELTKNIPMEKNQDVCALNENYKNVELLPPEKYMRVASPSRKVQ
FNQNTNLRVIQKNQEETTSISKITVNPDSEELFSDNENNFVFQVANERNN
LALGNTKELHETDLTCVNEPIFKNSTMVLYGDTGDKQATQVSIKKDLVYV
LAEENKNSVKQHIKMTLGQDLKSDISLNIDKIPEKNNDYMNKWAGLLGPI
SNHSFGGSFRTASNKEIKLSEHNIKKSKMFFKDIEEQYPTSLACVEIVNT
LALDNQKKLSKPQSINTVSAHLQSSVVVSDCKNSHITPQMLFSKQDFNSN
HNLTPSQKAEITELSTILEESGSQFEFTQFRKPSYILQKSTFEVPENQMT
ILKTTSEECRDADLHVIMNAPSIGQVDSSKQFEGTVEIKRKFAGLLKNDC
NKSASGYLTDENEVGFRGFYSAHGTKLNVSTEALQKAVKLFSDIENISEE
TSAEVHPISLSSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEM
TTGTFVEEITENYKRNTENEDNKYTAASRNSHNLEFDGSDSSKNDTVCIH
KDETDLLFTDQHNICLKLSGQFMKEGNTQIKEDLSDLTFLEVAKAQEACH
GNTSNKEQLTATKTEQNIKDFETSDTFFQTASGKNISVAKESFNKIVNFF
DQKPEELHNFSLNSELHSDIRKNKMDILSYEETDIVKHKILKESVPVGTG
NQLVTFQGQPERDEKIKEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKE
QGTSEITSFSHQWAKTLKYREACKDLELACETIEITAAPKCKEMQNSLNN
DKNLVSIETVVPPKLLSDNLCRQTENLKTSKSIFLKVKVHENVEKETAKS
PATCYTNQSPYSVIENSALAFYTSCSRKTSVSQTSLLEAKKWLREGIFDG
QPERINTADYVGNYLYENNSNSTIAENDKNHLSEKQDTYLSNSSMSNSYS
YHSDEVYNDSGYLSKNKLDSGIEPVLKNVEDQKNTSFSKVISNVKDANAY
PQTVNEDICVEELVTSSSPCKNKNAAIKLSISNSNNFEVGPPAFRIASGK
IVCVSHETIKKVKDIFTDSFSKVIKENNENKSKICQTKIMAGCYEALDDS
EDILHNSLDNDECSTHSHKVFADIQSEEILQHNQNMSGLEKVSKISPCDV
SLETSDICKCSIGKLHKSVSSANTCGIFSTASGKSVQVSDASLQNARQVF
SEIEDSTKQVFSKVLFKSNEHSDQLTREENTAIRTPEHLISQKGFSYNVV
NSSAFSGFSTASGKQVSILESSLHKVKGVLEEFDLIRTEHSLHYSPTSRQ
NVSKILPRVDKRNPEHCVNSEMEKTCSKEFKLSNNLNVEGGSSENNHSIK
VSPYLSQFQQDKQQLVLGTKVSLVENIHVLGKEQASPKNVKMEIGKTETF
SDVPVKTNIEVCSTYSKDSENYFETEAVEIAKAFMEDDELTDSKLPSHAT
HSLFTCPENEEMVLSNSRIGKRRGEPLILVGEPSIKRNLLNEFDRIIENQ
EKSLKASKSTPDGTIKDRRLFMHHVSLEPITCVPFRTTKERQEIQNPNFT
APGQEFLSKSHLYEHLTLEKSSSNLAVSGHPFYQVSATRNEKMRHLITTG
RPTKVFVPPFKTKSHFHRVEQCVRNINLEENRQKQNIDGHGSDDSKNKIN
DNEIHQFNKNNSNQAAAVTFTKCEEEPLDLITSLQNARDIQDMRIKKKQR
QRVFPQPGSLYLAKTSTLPRISLKAAVGGQVPSACSHKQLYTYGVSKHCI
KINSKNAESFQFHTEDYFGKESLWTGKGIQLADGGWLIPSNDGKAGKEEF
YRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKEFANRCLSPE
RVLLQLKYRYDTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSANI
SETSSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQK
IILHGAELVGSPDACTPLEAPESLMLKISANSTRPARWYTKLGFFPDPRP
FPLPLSSLFSDGGNVGCVDVIIQRAYPIQWMEKTSSGLYIFRNEREEEKE
AAKYVEAQQKRLEALFTKIQEEFEEHEENTTKPYLPSRALTRQQVRALQD
GAELYEAVKNAADPAYLEGYFSEEQLRALNNHRQMLNDKKQAQIQLEIRK
AMESAEQKEQGLSRDVTTVWKLRIVSYSKKEKDSVILSIWRPSSDLYSLL
TEGKRYRIYHLATSKSKSKSERANIQLAATKKTQYQQLPVSDEILFQIYQ
PREPLHFSKFLDPDFQPSCSEVDLIGFVVSVVKKTGLAPFVYLSDECYNL
LAIKFWIDLNEDIIKPHMLIAASNLQWRPESKSGLLTLFAGDFSVFSASP
KEGHFQETFNKMKNTVENIDILCNEAENKLMHILHANDPKWSTPTKDCTS
GPYTAQIIPGTGNKLLMSSPNCEIYYQSPLSLCMAKRKSVSTPVSAQMTS
KSCKGEKEIDDQKNCKKRRALDFLSRLPLPPPVSPICTFVSPAAQKAFQP
PRSCGTKYETPIKKKELNSPQMTPFKKFNEISLLESNSIADEELALINTQ
ALLSGSTGEKQFISVSESTRTAPTSSEDYLRLKRRCTTSLIKEQESSQAS
TEECEKNKQDTITTKKYI

BRCA2 (Homo sapiens) is able to recognize following damages:
BRCA2 (Homo sapiens) belongs to following protein families:
References:

Title Authors Journal
Identification of the breast cancer susceptibility gene BRCA2. Wooster R, Bignell G, Lancaster J, Swift S, Seal S, Mangion J, Collins N, Gregory S, Gumbs C, Micklem G Nature Jan. 1, 1995
The complete BRCA2 gene and mutations in chromosome 13q-linked kindreds. Tavtigian SV, Simard J, Rommens J, Couch F, Shattuck-Eidens D, Neuhausen S, Merajver S, Thorlacius S, Offit K, Stoppa-Lyonnet D, Belanger C, Bell R, Berry S, Bogden R, Chen Q, Davis T, Dumont M, Frye C, Hattier T, Jammulapati S, Janecki T, Jiang P, Kehrer R, Leblanc JF, Mitchell JT, McArthur-Morrison J, Nguyen K, Peng Y, Samson C, Schroeder M, Snyder SC, Steele L, Stringfellow M, Stroup C, Swedlund B, Swense J, Teng D, Thomas A, Tran T, Tranchant M, Weaver-Feldhaus J, Wong AK, Shizuya H, Eyfjord JE, Cannon-Albright L, Tranchant M, Labrie F, Skolnick MH, Weber B, Kamb A, Goldgar DE Nat Genet March 1, 1996
BRCA2 germline mutations in male breast cancer cases and breast cancer families. Couch FJ, Farid LM, DeShano ML, Tavtigian SV, Calzone K, Campeau L, Peng Y, Bogden B, Chen Q, Neuhausen S, Shattuck-Eidens D, Godwin AK, Daly M, Radford DM, Sedlacek S, Rommens J, Simard J, Garber J, Merajver S, Weber BL Nat Genet May 1, 1996
BRCA2 mutations in primary breast and ovarian cancers. Lancaster JM, Wooster R, Mangion J, Phelan CM, Cochran C, Gumbs C, Seal S, Barfoot R, Collins N, Bignell G, Patel S, Hamoudi R, Larsson C, Wiseman RW, Berchuck A, Iglehart JD, Marks JR, Ashworth A, Stratton MR, Futreal PA Nat Genet June 1, 1996
Low incidence of BRCA2 mutations in breast carcinoma and other cancers. Teng DH, Bogden R, Mitchell J, Baumgard M, Bell R, Berry S, Davis T, Ha PC, Kehrer R, Jammulapati S, Chen Q, Offit K, Skolnick MH, Tavtigian SV, Jhanwar S, Swedlund B, Wong AK, Kamb A Nat Genet June 1, 1996
Mutation analysis in the BRCA2 gene in primary breast cancers. Miki Y, Katagiri T, Kasumi F, Yoshimoto T, Nakamura Y Nat Genet June 1, 1996
Mutations of the BRCA2 gene in ovarian carcinomas. Takahashi H, Chiu HC, Bandera CA, Behbakht K, Liu PC, Couch FJ, Weber BL, LiVolsi VA, Furusato M, Rebane BA, Cardonick A, Benjamin I, Morgan MA, King SA, Mikuta JJ, Rubin SC, Boyd J Cancer Res June 15, 1996
A low proportion of BRCA2 mutations in Finnish breast cancer families. Vehmanen P, Friedman LS, Eerola H, Sarantaus L, Pyrhonen S, Ponder BA, Muhonen T, Nevanlinna H Am J Hum Genet May 1, 1997
High proportion of missense mutations of the BRCA1 and BRCA2 genes in Japanese breast cancer families. Katagiri T, Kasumi F, Yoshimoto M, Nomizu T, Asaishi K, Abe R, Tsuchiya A, Sugano M, Takai S, Yoneda M, Fukutomi T, Nanba K, Makita M, Okazaki H, Hirata K, Okazaki M, Furutsuma Y, Morishita Y, Iino Y, Karino T, Ayabe H, Hara S, Kajiwara T, Houga S, Miki Y, et al. J Hum Genet Jan. 1, 1998
High throughput fluorescence-based conformation-sensitive gel electrophoresis (F-CSGE) identifies six unique BRCA2 mutations and an overall low incidence of BRCA2 mutations in high-risk BRCA1-negative breast cancer families. Ganguly T, Dhulipala R, Godmilow L, Ganguly A Hum Genet May 1, 1998
Molecular characterization of germline mutations in the BRCA1 and BRCA2 genes from breast cancer families in Taiwan. Li SS, Tseng HM, Yang TP, Liu CH, Teng SJ, Huang HW, Chen LM, Kao HW, Chen JH, Tseng JN, Chen A, Hou MF, Huang TJ, Chang HT, Mok KT, Tsai JH Hum Genet March 1, 1999
Global sequence diversity of BRCA2: analysis of 71 breast cancer families and 95 control individuals of worldwide populations. Wagner TM, Hirtenlehner K, Shen P, Moeslinger R, Muhr D, Fleischmann E, Concin H, Doeller W, Haid A, Lang AH, Mayer P, Petru E, Ropp E, Langbauer G, Kubista E, Scheiner O, Underhill P, Mountain J, Stierer M, Zielinski C, Oefner P Hum Mol Genet March 1, 1999
Germline brca2 sequence variants in patients with ocular melanoma. Sinilnikova OM, Egan KM, Quinn JL, Boutrand L, Lenoir GM, Stoppa-Lyonnet D, Desjardins L, Levy C, Goldgar D, Gragoudas ES Int J Cancer July 1, 1999
The contribution of germline BRCA1 and BRCA2 mutations to familial ovarian cancer: no evidence for other ovarian cancer-susceptibility genes. Gayther SA, Russell P, Harrington P, Antoniou AC, Easton DF, Ponder BA Am J Hum Genet Oct. 1, 1999
BRCA2 germline mutations among early onset breast cancer patients unselected for family history of the disease. Plaschke J, Commer T, Jacobi C, Schackert HK, Chang-Claude J J Med Genet Sept. 1, 2000
A common variant in BRCA2 is associated with both breast cancer risk and prenatal viability. Healey CS, Dunning AM, Teare MD, Chase D, Parker L, Burn J, Chang-Claude J, Mannermaa A, Kataja V, Huntsman DG, Pharoah PD, Luben RN, Easton DF, Ponder BA Nat Genet Nov. 1, 2000
BRCA2 germline mutations in male breast cancer patients in the Polish population. Kwiatkowska E, Teresiak M, Lamperska KM, Karczewska A, Breborowicz D, Stawicka M, Godlewski D, Krzyzosiak WJ, Mackiewicz A Hum Mutat Jan. 1, 2001
An improved high throughput heteroduplex mutation detection system for screening BRCA2 mutations-fluorescent mutation detection (F-MD). Edwards SM, Kote-Jarai Z, Hamoudi R, Eeles RA Hum Mutat March 1, 2001
Characterization of common BRCA1 and BRCA2 variants. Deffenbaugh AM, Frank TS, Hoffman M, Cannon-Albright L, Neuhausen SL Genet Test Jan. 1, 2002
Infrequent mutation in the BRCA2 gene in esophageal squamous cell carcinoma. Hu N, Li G, Li WJ, Wang C, Goldstein AM, Tang ZZ, Roth MJ, Dawsey SM, Huang J, Wang QH, Ding T, Giffen C, Taylor PR, Emmert-Buck MR Clin Cancer Res April 1, 2002
Somatic mutations in the BRCA2 gene and high frequency of allelic loss of BRCA2 in sporadic male breast cancer. Kwiatkowska E, Teresiak M, Breborowicz D, Mackiewicz A Int J Cancer April 20, 2002
Evaluation of candidate genes MAP2K4, MADH4, ACVR1B, and BRCA2 in familial pancreatic cancer: deleterious BRCA2 mutations in 17%. Murphy KM, Brune KA, Griffin C, Sollenberger JE, Petersen GM, Bansal R, Hruban RH, Kern SE Cancer Res July 1, 2002
Biallelic inactivation of BRCA2 in Fanconi anemia. Howlett NG, Taniguchi T, Olson S, Cox B, Waisfisz Q, De Die-Smulders C, Persky N, Grompe M, Joenje H, Pals G, Ikeda H, Fox EA, D'Andrea AD Science July 26, 2002
BRCA2 T2722R is a deleterious allele that causes exon skipping. Fackenthal JD, Cartegni L, Krainer AR, Olopade OI Am J Hum Genet Sept. 1, 2002
BRCA2 gene mutations in families with aggregations of breast and stomach cancers. Jakubowska A, Nej K, Huzarski T, Scott RJ, Lubinski J Br J Cancer Oct. 7, 2002
Insights into DNA recombination from the structure of a RAD51-BRCA2 complex. Pellegrini L, Yu DS, Lo T, Anand S, Lee M, Blundell TL, Venkitaraman AR Nature Nov. 21, 2002
BRCA1 and BRCA2 sequence variants in Chinese breast cancer families. Zhi X, Szabo C, Chopin S, Suter N, Wang QS, Ostrander EA, Sinilnikova OM, Lenoir GM, Goldgar D, Shi YR Hum Mutat Dec. 1, 2002
BRCA1 and BRCA2 mutation analysis of early-onset and familial breast cancer cases in Mexico. Ruiz-Flores P, Sinilnikova OM, Badzioch M, Calderon-Garciduenas AL, Chopin S, Fabrice O, Gonzalez-Guerrero JF, Szabo C, Lenoir G, Goldgar DE, Barrera-Saldana HA Hum Mutat Dec. 1, 2002
BRCA1 and BRCA2 in Indian breast cancer patients. Saxena S, Szabo CI, Chopin S, Barjhoux L, Sinilnikova O, Lenoir G, Goldgar DE, Bhatanager D Hum Mutat Dec. 1, 2002
BRCA2 germline mutations in Cypriot patients with familial breast/ovarian cancer. Hadjisavvas A, Charalambous E, Adamou A, Christodoulou CG, Kyriacou K Hum Mutat Jan. 1, 2003
Evaluation of the diagnostic accuracy of the stop codon (SC) assay for identifying protein-truncating mutations in the BRCA1and BRCA2genes in familial breast cancer. Sakayori M, Kawahara M, Shiraishi K, Nomizu T, Shimada A, Kudo T, Abe R, Ohuchi N, Takenoshita S, Kanamaru R, Ishioka C J Hum Genet Jan. 1, 2003
BRCA2 germline mutations in familial pancreatic carcinoma. Hahn SA, Greenhalf B, Ellis I, Sina-Frey M, Rieder H, Korte B, Gerdes B, Kress R, Ziegler A, Raeburn JA, Campra D, Grutzmann R, Rehder H, Rothmund M, Schmiegel W, Neoptolemos JP, Bartsch DK J Natl Cancer Inst Jan. 5, 2003
Twenty-three novel BRCA1 and BRCA2 sequence alterations in breast and/or ovarian cancer families in Southern Germany. Meyer P, Voigtlaender T, Bartram CR, Klaes R Hum Mutat Sept. 1, 2003
One in 10 ovarian cancer patients carry germ line BRCA1 or BRCA2 mutations: results of a prospective study in Southern Sweden. Malander S, Ridderheim M, Masback A, Loman N, Kristoffersson U, Olsson H, Nilbert M, Borg A Eur J Cancer Jan. 1, 2004
Novel germline mutations in the BRCA1 and BRCA2 genes in Indian breast and breast-ovarian cancer families. Valarmathi MT, Sawhney M, Deo SS, Shukla NK, Das SN Hum Mutat Jan. 1, 2004
BRCA1 and BRCA2 germline mutation spectrum and frequencies in Belgian breast/ovarian cancer families. Claes K, Poppe B, Coene I, Paepe AD, Messiaen L Br J Cancer March 22, 2004
The DNA sequence and analysis of human chromosome 13. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT Nature April 1, 2004
Association of biallelic BRCA2/FANCD1 mutations with spontaneous chromosomal instability and solid tumors of childhood. Hirsch B, Shimamura A, Moreau L, Baldinger S, Hag-alshiekh M, Bostrom B, Sencer S, D'Andrea AD Blood April 1, 2004
Hereditary breast and ovarian cancer in Cyprus: identification of a founder BRCA2 mutation. Hadjisavvas A, Charalambous E, Adamou A, Neuhausen SL, Christodoulou CG, Kyriacou K Cancer Genet Cytogenet June 1, 2004
Direct interaction of FANCD2 with BRCA2 in DNA damage response pathways. Hussain S, Wilson JB, Medhurst AL, Hejna J, Witt E, Ananth S, Davies A, Masson JY, Moses R, West SC, de Winter JP, Ashworth A, Jones NJ, Mathew CG Hum Mol Genet June 15, 2004
Functional interaction of monoubiquitinated FANCD2 and BRCA2/FANCD1 in chromatin. Wang X, Andreassen PR, D'Andrea AD Mol Cell Biol July 1, 2004
BRCA2 is ubiquitinated in vivo and interacts with USP11, a deubiquitinating enzyme that exhibits prosurvival function in the cellular response to DNA damage. Schoenfeld AR, Apgar S, Dolios G, Wang R, Aaronson SA Mol Cell Biol Sept. 1, 2004
RNA analysis reveals splicing mutations and loss of expression defects in MLH1 and BRCA1. Sharp A, Pichert G, Lucassen A, Eccles D Hum Mutat Sept. 1, 2004
BRCA1 and BRCA2 germline mutations in Korean patients with sporadic breast cancer. Seo JH, Cho DY, Ahn SH, Yoon KS, Kang CS, Cho HM, Lee HS, Choe JJ, Choi CW, Kim BS, Shin SW, Kim YH, Kim JS, Son GS, Lee JB, Koo BH Hum Mutat Oct. 1, 2004
Prevalence of BRCA2 mutations in a hospital based series of unselected breast cancer cases. Kim SW, Lee CS, Fey JV, Borgen PI, Boyd J J Med Genet Feb. 1, 2005
WDRPUH, a novel WD-repeat-containing protein, is highly expressed in human hepatocellular carcinoma and involved in cell proliferation. Silva FP, Hamamoto R, Nakamura Y, Furukawa Y Neoplasia April 1, 2005
Fanconi anemia complementation group D2 (FANCD2) functions independently of BRCA2- and RAD51-associated homologous recombination in response to DNA damage. Ohashi A, Zdzienicka MZ, Chen J, Couch FJ J Biol Chem April 15, 2005
Control of BRCA2 cellular and clinical functions by a nuclear partner, PALB2. Xia B, Sheng Q, Nakanishi K, Ohashi A, Wu J, Christ N, Liu X, Jasin M, Couch FJ, Livingston DM Mol Cell June 23, 2006
Clinical and molecular features associated with biallelic mutations in FANCD1/BRCA2. Alter BP, Rosenberg PS, Brody LC J Med Genet Feb. 1, 2007
ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ Science May 25, 2007
Structural basis for recruitment of BRCA2 by PALB2. Oliver AW, Swift S, Lord CJ, Ashworth A, Pearl LH EMBO Rep Sept. 1, 2009


Last modification of this entry: June 19, 2013.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.