Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Rad52p |
Rad52p is involved in:
HRR in Saccharomyces cerevisiae
Keywords:
FUNCTION: Involved in DNA double-strand break (DSB) repair and recombination. Promotes the annealing of complementary single- stranded DNA and by stimulation of the RAD51 recombinase.
SUBUNIT: Part of a complex that includes RAD51, RAD52 and RAD59. Interacts with SAW1.
INTERACTION: P40047:ALD5; NbExp=1; IntAct=EBI-14719, EBI-5792;
SUBCELLULAR LOCATION: Nucleus.
MISCELLANEOUS: Present with 1080 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the RAD52 family.
SEQUENCE CAUTION: Sequence=AAA50352.1; Type=Erroneous initiation; Sequence=AAT93163.1; Type=Erroneous initiation; Sequence=CAA86623.1; Type=Erroneous initiation;
| NCBI GenPept GI number(s): |
575687 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P06778 |
P06778 |
| PFAM: | - |
P06778 (Link - using uniprot id) |
| InterPro: | - |
P06778 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MAFLSYFATENQQMQTRRLPRTAEGSGGFGVLLMNEIMDMDEKKPVFGNH SEDIQTKLDKKLGPEYISKRVGFGTSRIAYIEGWRVINLANQIFGYNGWS TEVKSVVIDFLDERQGKFSIGCTAIVRVTLTSGTYREDIGYGTVENERRK PAAFERAKKSAVTDALKRSLRGFGNALGNCLYDKDFLAKIDKVKFDPPDF DENNLFRPTDEISESSRTNTLHENQEQQQYPNKRRQLTKVTNTNPDSTKN LVKIENTVSRGTPMMAAPAEANSKNSSNKDTDLKSLDASKQDQDDLLDDS LMFSDDFQDDDLINMGNTNSNVLTTEKDPVVAKQSPTASSNPEAEQITFV TAKAATSVQNERYIGEESIFDPKYQAQSIRHTVDQTTSKHIPASVLKDKT MTTARDSVYEKFAPKGKQLSMKNNDKELGPHMLEGAGNQVPRETTPIKTN ATAFPPAAAPRFAPPSKVVHPNGNGAVPAVPQQRSTRREVGRPKINPLHA RKPT |
Rad52p (Saccharomyces cerevisiae) is able to recognize following damages:
References:
| Title | Authors | Journal |
| Primary structure of the RAD52 gene in Saccharomyces cerevisiae. | Adzuma K, Ogawa T, Ogawa H | Mol Cell Biol Dec. 1, 1984 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII. | Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B | Nature May 1, 1997 |
| The Rad52-Rad59 complex interacts with Rad51 and replication protein A. | Davis AP, Symington LS | DNA Repair (Amst) Oct. 7, 2003 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Multiple start codons and phosphorylation result in discrete Rad52 protein species. | Antunez de Mayolo A, Lisby M, Erdeniz N, Thybo T, Mortensen UH, Rothstein R | Nucleic Acids Res Jan. 1, 2006 |
| Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. | Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J | Genome Res April 1, 2007 |
| Microarray-based genetic screen defines SAW1, a gene required for Rad1/Rad10-dependent processing of recombination intermediates. | Li F, Dong J, Pan X, Oum JH, Boeke JD, Lee SE | Mol Cell May 9, 2008 |
| A multidimensional chromatography technology for in-depth phosphoproteome analysis. | Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H | Mol Cell Proteomics July 1, 2008 |
Last modification of this entry: Oct. 21, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|