Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Rad52p

Rad52p (Saccharomyces cerevisiae) is product of expression of RAD52 gene.


Rad52p is involved in:

HRR in Saccharomyces cerevisiae

Keywords:



FUNCTION: Involved in DNA double-strand break (DSB) repair and recombination. Promotes the annealing of complementary single- stranded DNA and by stimulation of the RAD51 recombinase.

SUBUNIT: Part of a complex that includes RAD51, RAD52 and RAD59. Interacts with SAW1.

INTERACTION: P40047:ALD5; NbExp=1; IntAct=EBI-14719, EBI-5792;

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: Present with 1080 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the RAD52 family.

SEQUENCE CAUTION: Sequence=AAA50352.1; Type=Erroneous initiation; Sequence=AAT93163.1; Type=Erroneous initiation; Sequence=CAA86623.1; Type=Erroneous initiation;


NCBI GenPept GI number(s): 575687
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P06778 P06778
PFAM: - P06778 (Link - using uniprot id)
InterPro: - P06778 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MAFLSYFATENQQMQTRRLPRTAEGSGGFGVLLMNEIMDMDEKKPVFGNH
SEDIQTKLDKKLGPEYISKRVGFGTSRIAYIEGWRVINLANQIFGYNGWS
TEVKSVVIDFLDERQGKFSIGCTAIVRVTLTSGTYREDIGYGTVENERRK
PAAFERAKKSAVTDALKRSLRGFGNALGNCLYDKDFLAKIDKVKFDPPDF
DENNLFRPTDEISESSRTNTLHENQEQQQYPNKRRQLTKVTNTNPDSTKN
LVKIENTVSRGTPMMAAPAEANSKNSSNKDTDLKSLDASKQDQDDLLDDS
LMFSDDFQDDDLINMGNTNSNVLTTEKDPVVAKQSPTASSNPEAEQITFV
TAKAATSVQNERYIGEESIFDPKYQAQSIRHTVDQTTSKHIPASVLKDKT
MTTARDSVYEKFAPKGKQLSMKNNDKELGPHMLEGAGNQVPRETTPIKTN
ATAFPPAAAPRFAPPSKVVHPNGNGAVPAVPQQRSTRREVGRPKINPLHA
RKPT

Rad52p (Saccharomyces cerevisiae) is able to recognize following damages:
References:

Title Authors Journal
Primary structure of the RAD52 gene in Saccharomyces cerevisiae. Adzuma K, Ogawa T, Ogawa H Mol Cell Biol Dec. 1, 1984
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII. Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B Nature May 1, 1997
The Rad52-Rad59 complex interacts with Rad51 and replication protein A. Davis AP, Symington LS DNA Repair (Amst) Oct. 7, 2003
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Multiple start codons and phosphorylation result in discrete Rad52 protein species. Antunez de Mayolo A, Lisby M, Erdeniz N, Thybo T, Mortensen UH, Rothstein R Nucleic Acids Res Jan. 1, 2006
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res April 1, 2007
Microarray-based genetic screen defines SAW1, a gene required for Rad1/Rad10-dependent processing of recombination intermediates. Li F, Dong J, Pan X, Oum JH, Boeke JD, Lee SE Mol Cell May 9, 2008
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics July 1, 2008


Last modification of this entry: Oct. 21, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.