Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Rad23a

Protein FULL name:

UV excision repair protein RAD23 homolog A [Mus musculus].


Rad23a (Mus musculus) is product of expression of Rad23a gene.






FUNCTION: Involved in postreplication repair of UV-damaged DNA. Postreplication repair functions in gap-filling of a daughter strand on replication of damaged DNA (Potential).

SUBCELLULAR LOCATION: Nucleus (Probable).

PTM: Phosphorylated upon DNA damage, probably by ATM or ATR.

SIMILARITY: Belongs to the RAD23 family.

SIMILARITY: Contains 2 UBA domains.

SIMILARITY: Contains 1 ubiquitin-like domain.


NCBI GenPept GI number(s): 34447211
Species: Mus musculus

Links to other databases:

Database ID Link
Uniprot P54726 P54726
PFAM: - P54726 (Link - using uniprot id)
InterPro: - P54726 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIY
AGKILSDDVPIKEYHIDEKNFVVVMVTKAKAGQGIPAPPEASPTAVPEPS
TPFPPVLASGMSHPPPTSREDKSPSEESTTTTSPESISGSVPSSGSSGRE
EDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLT
GIPGSPEPEHGSVQESQAPEQPATEAGENPLEFLRDQPQFQNMRQVIQQN
PALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGEV
GAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLA
ANFLLSQNFDDE

Rad23a (Mus musculus) belongs to following protein families:
References:

Title Authors Journal
Cloning, comparative mapping, and RNA expression of the mouse homologues of the Saccharomyces cerevisiae nucleotide excision repair gene RAD23. van der Spek PJ, Visser CE, Hanaoka F, Smit B, Hagemeijer A, Bootsma D, Hoeijmakers JH Genomics Feb. 1, 1996
Large-scale phosphorylation analysis of mouse liver. Villen J, Beausoleil SA, Gerber SA, Gygi SP Proc Natl Acad Sci U S A Feb. 1, 2007
ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ Science May 25, 2007


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.