Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Mre11p

Mre11p (Saccharomyces cerevisiae) is product of expression of MRE11 gene.


Mre11p is involved in:

NHEJ in Saccharomyces cerevisiae HRR in Saccharomyces cerevisiae

Keywords:



FUNCTION: Involved in DNA double-strand break repair (DSBR). Possesses single-strand endonuclease activity and double-strand- specific 3'-5' exonuclease activity. Also involved in meiotic DSB processing.

COFACTOR: Manganese (By similarity).

SUBUNIT: Forms a complex with RAD50 and XRS2.

INTERACTION: Q06032:CST9; NbExp=1; IntAct=EBI-11255, EBI-30044;

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: Present with 432 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the MRE11/RAD32 family.


NCBI GenPept GI number(s): 1513065
6323880
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P32829 P32829
PFAM: - P32829 (Link - using uniprot id)
InterPro: - P32829 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MDYPDPDTIRILITTDNHVGYNENDPITGDDSWKTFHEVMMLAKNNNVDM
VVQSGDLFHVNKPSKKSLYQVLKTLRLCCMGDKPCELELLSDPSQVFHYD
EFTNVNYEDPNFNISIPVFGISGNHDDASGDSLLCPMDILHATGLINHFG
KVIESDKIKVVPLLFQKGSTKLALYGLAAVRDERLFRTFKDGGVTFEVPT
MREGEWFNLMCVHQNHTGHTNTAFLPEQFLPDFLDMVIWGHEHECIPNLV
HNPIKNFDVLQPGSSVATSLCEAEAQPKYVFILDIKYGEAPKMTPIPLET
IRTFKMKSISLQDVPHLRPHDKDATSKYLIEQVEEMIRDANEETKQKLAD
DGEGDMVAELPKPLIRLRVDYSAPSNTQSPIDYQVENPRRFSNRFVGRVA
NGNNVVQFYKKRSPVTRSKKSGINGTSISDRDVEKLFSESGGELEVQTLV
NDLLNKMQLSLLPEVGLNEAVKKFVDKDEKTALKEFISHEISNEVGILST
NEEFLRTDDAEEMKALIKQVKRANSVRPTPPKENDETNFAFNGNGLDSFR
SSNREVRTGSPDITQSHVDNESRITHISQAESSKPTSKPKRVRTATKKKI
PAFSDSTVISDAENELGDNNDAQDDVDIDENDIIMVSTDEEDASYGLLNG
RKTKTKTRPAASTKTASRRGKGRASRTPKTDILGSLLAKKRK

Mre11p (Saccharomyces cerevisiae) is able to recognize following damages:
References:

Title Authors Journal
Functions of the yeast meiotic recombination genes, MRE11 and MRE2. Ogawa H, Johzuka K, Nakagawa T, Leem SH, Hagihara AH Adv Biophys Jan. 1, 1995
Interaction of Mre11 and Rad50: two proteins required for DNA repair and meiosis-specific double-strand break formation in Saccharomyces cerevisiae. Johzuka K, Ogawa H Genetics April 1, 1995
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII. Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B Nature May 1, 1997
The 3' to 5' exonuclease activity of Mre 11 facilitates repair of DNA double-strand breaks. Paull TT, Gellert M Mol Cell June 1, 1998
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A June 19, 2007
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics July 1, 2008


Last modification of this entry: Oct. 16, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.