Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Polm |
Protein FULL name:
polymerase (DNA directed), mu [Mus musculus].
Polm (Mus musculus) is product of expression of Polm gene.
FUNCTION: Seems to act as an Ig mutase which is responsible for immunoglobulin (Ig) gene hypermutation.
CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).
COFACTOR: Magnesium (By similarity).
SUBCELLULAR LOCATION: Nucleus (By similarity).
SIMILARITY: Belongs to the DNA polymerase type-X family.
SIMILARITY: Contains 1 BRCT domain.
| NCBI GenPept GI number(s): |
8394001 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q9JIW4 |
Q9JIW4 |
| PFAM: | - |
Q9JIW4 (Link - using uniprot id) |
| InterPro: | - |
Q9JIW4 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MLPKRRRVRAGSPHSAVASSTPPSVVRFPDVAIYLAEPRMGRSRRAFLTR LARSKGFRVLDAYSSKVTHVVMEGTSAKEAICWQKNMDALPTGCPQPALL DISWFTESMAAGQPVPEEGRHHLEVAEPRKEPPVSASMPAYACQRPSPLT HHNTLLSEALETLAEAAGFEANEGRLLSFSRAASVLKSLPCPVASLSQLH GLPYFGEHSTRVIQELLEHGTCEEVKQVRCSERYQTMKLFTQVFGVGVKT ANRWYQEGLRTLDELREQPQRLTQQQKAGLQYYQDLSTPVRRADAEALQQ LIEAAVRQTLPGATVTLTGGFRRGKLQGHDVDFLITHPEEGQEVGLLPKV MSCLQSQGLVLYHQYHRSHLADSAHNLRQRSSTMDVFERSFCILGLPQPQ QAALAGALPPCPTWKAVRVDLVVTPSSQFPFALLGWTGSQFFERELRRFS RQEKGLWLNSHGLFDPEQKRVFHATSEEDVFRLLGLKYLPPEQRNA |
Polm (Mus musculus) is able to recognize following damages:
Polm (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| DNA polymerase mu (Pol mu), homologous to TdT, could act as a DNA mutator in eukaryotic cells. | Dominguez O, Ruiz JF, Lain de Lera T, Garcia-Diaz M, Gonzalez MA, Kirchhoff T, Martinez-A C, Bernad A, Blanco L | EMBO J April 3, 2000 |
| Two novel human and mouse DNA polymerases of the polX family. | Aoufouchi S, Flatter E, Dahan A, Faili A, Bertocci B, Storck S, Delbos F, Cocea L, Gupta N, Weill JC, Reynaud CA | Nucleic Acids Res Sept. 15, 2000 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|