Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Fen1 |
Protein FULL name:
flap endonuclease 1 [Mus musculus].
Fen1 (Mus musculus) is product of expression of Fen1 gene.
FUNCTION: Endonuclease that cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. It fails to cleave other DNA structures, including 3'-flaps and single stranded DNA.
COFACTOR: Binds 2 magnesium ions per subunit. They probably participate in the reaction catalyzed by the enzyme. May bind an additional third magnesium ion after substrate binding (By similarity).
SUBUNIT: Interacts with PCNA. The C-terminal domain binds EP300. Can bind simultaneously to both PCNA and EP300 (By similarity).
SUBCELLULAR LOCATION: Nucleus (Probable).
PTM: Acetylated by EP300. Acetylation inhibits both endonuclease and exonuclease activity, and reduces the DNA-binding activity but does not affect interaction with PCNA or EP300 (By similarity).
SIMILARITY: Belongs to the XPG/RAD2 endonuclease family. FEN1 subfamily.
| NCBI GenPept GI number(s): |
46048490 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | P39749 |
P39749 |
| PFAM: | - |
P39749 (Link - using uniprot id) |
| InterPro: | - |
P39749 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MGIHGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGG DVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKR SERRAEAEKQLQQAQEAGMEEEVEKFTKRLVKVTKQHNDECKHLLSLMGI PYLDAPSEAEASCAALAKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAK KLPIQEFHLSRVLQELGLNQEQFVDLCILLGSDYCESIRGIGPKRAVDLI QKHKSIEEIVRRLDPSKYPVPENWLHKEAQQLFLEPEVLDPESVELKWSE PNEEELVKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSL SSAKRKEPEPKGPAKKKAKTGGAGKFRRGK |
Fen1 (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| Functional domains within FEN-1 and RAD2 define a family of structure-specific endonucleases: implications for nucleotide excision repair. | Harrington JJ, Lieber MR | Genes Dev June 1, 1994 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|