Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Mlh1 |
Protein FULL name:
MutL protein homolog 1 [Mus musculus].
Mlh1 (Mus musculus) is product of expression of Mlh1 gene.
FUNCTION: Heterodimerizes with Pms2 to form MutL alpha, a component of the post-replicative DNA mismatch repair system (MMR). DNA repair is initiated by MutS alpha (Msh2-Msh6) or MutS beta (Msh2-Msh6) binding to a dsDNA mismatch, then MutL alpha is recruited to the heteroduplex. Assembly of the MutL-MutS- heteroduplex ternary complex in presence of RFC and PCNA is sufficient to activate endonuclease activity of Pms2. It introduces single-strand breaks near the mismatch and thus generates new entry points for the exonuclease EXO1 to degrade the strand containing the mismatch. DNA methylation would prevent cleavage and therefore assure that only the newly mutated DNA strand is going to be corrected. MutL alpha (Mlh1-Pms2) interacts physically with the clamp loader subunits of DNA polymerase III, suggesting that it may play a role to recruit the DNA polymerase III to the site of the MMR. Also implicated in DNA damage signaling, a process which induces cell cycle arrest and can lead to apoptosis in case of major DNA damages. Heterodimerizes with Mlh3 to form MutL gamma which plays a role in meiosis (By similarity).
SUBUNIT: Heterodimer of Mlh1 and Pms2 (MutL alpha), Mlh1 and Pms1 (MutL beta) or Mlh1 and Mlh3 (MutL gamma). Forms a ternary complex with MutS alpha (Msh2-Msh6) or MutS beta (Msh2-Msh3). Part of the BRCA1-associated genome surveillance complex (BASC), which contains BRCA1, Msh2, Msh6, Mlh1, Atm, Blm, Pms2 and the RAD50- MRE11-NBS1 protein complex. This association could be a dynamic process changing throughout the cell cycle and within subnuclear domains. Interacts with MBD4. Interacts with EXO1 (By similarity).
SUBCELLULAR LOCATION: Nucleus (By similarity).
SIMILARITY: Belongs to the DNA mismatch repair mutL/hexB family.
| NCBI GenPept GI number(s): |
19387852 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q9JK91 |
Q9JK91 |
| PFAM: | - |
Q9JK91 (Link - using uniprot id) |
| InterPro: | - |
Q9JK91 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MAFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTNIQVV VKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQTFEDLASISTYGFR GEALASISHVAHVTITTKTADGKCAYRASYSDGKLQAPPKPCAGNQGTLI TVEDLFYNIITRRKALKNPSEEYGKILEVVGRYSIHNSGISISVKKQGET VSDVRTLPNATTVDNIRSIFGNAVSRELIEVGCEDKTLAFKMNGYISNAN YSVKKCIFLLFINHRLVESAALRKAIETVYAAYLPKNTHPFLYLSLEISP QNVDVNVHPTKHEVHFLHEESILQRVQQHIESKLLGSNSSRMYFTQTLLP GLAGPSGEAARPTTGVASSSTSGSGDKVYAYQMVRTDSRDQKLDAFLQPV SSLVPSQPQDPAPVRGARTEGSPERATREDEEMLALPAPAEAAAESENLE RESLMETSDTAQKAAPTSSPGSSRKRHREDSDVEMVENASGKEMTAACYP RRRIINLTSVLSLQEEISERCHETLREMLRNHSFVGCVNPQWALAQHQTK LYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESG WTEDDGPKEGLAEYIVEFLKKKAEMLADYFSVEIDEEGNLIGLPLLIDSY VPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYILEEST LSGQQSDMPGSTSKPWKWTVEHIIYKAFRSHLLPPKHFTEDGNVLQLANL PDLYKVFERC |
Mlh1 (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| Meiotic pachytene arrest in MLH1-deficient mice. | Edelmann W, Cohen PE, Kane M, Lau K, Morrow B, Bennett S, Umar A, Kunkel T, Cattoretti G, Chaganti R, Pollard JW, Kolodner RD, Kucherlapati R | Cell June 28, 1996 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|