Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Pms2

Protein FULL name:

mismatch repair endonuclease PMS2 [Mus musculus].


Pms2 (Mus musculus) is product of expression of Pms2 gene.






FUNCTION: Component of the post-replicative DNA mismatch repair system (MMR). Heterodimerizes with Mlh1 to form MutL alpha. DNA repair is initiated by MutS alpha (Msh2-Msh6) or MutS beta (Msh2- Msh6) binding to a dsDNA mismatch, then MutL alpha is recruited to the heteroduplex. Assembly of the MutL-MutS-heteroduplex ternary complex in presence of RFC and PCNA is sufficient to activate endonuclease activity of pms2. It introduces single-strand breaks near the mismatch and thus generates new entry points for the exonuclease EXO1 to degrade the strand containing the mismatch. DNA methylation would prevent cleavage and therefore assure that only the newly mutated DNA strand is going to be corrected. MulL alpha (Mlh1-PMS2) interacts physically with the clamp loader subunits of DNA polymerase III, suggesting that it may play a role to recruit the DNA polymerase III to the site of the MMR. Also implicated in DNA damage signaling, a process which induces cell cycle arrest and can lead to apoptosis in case of major DNA damages (By similarity).

SUBUNIT: Heterodimer of PMS2 and Mlh1 (MutL alpha). Forms a ternary complex with MutS alpha (Msh2-Msh6) or MutS beta (Msh2- Msh3).

SUBCELLULAR LOCATION: Nucleus (By similarity).

SIMILARITY: Belongs to the DNA mismatch repair mutL/hexB family.


NCBI GenPept GI number(s): 121583910
Species: Mus musculus

Links to other databases:

Database ID Link
Uniprot P54279 P54279
PFAM: - P54279 (Link - using uniprot id)
InterPro: - P54279 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MEQTEGVSTECAKAIKPIDGKSVHQICSGQVVLSLSTAVKELIENSVDAG
ATTIDLRLKDYGVDLIEVSDNGCGVEEENFEGLALKHHTSKIQEFADLTQ
VETFGFRGEALSSLCALSDVTISTCHGSASVGTRLVFDHNGKITQKTPYP
RPKGTTVSVQHLFYTLPVRYKEFQRNIKKEYAKMVQVLQAYCIISAGVRV
SCTNQLGQGKRQPVVCTSGSSGMKENIGSVFGQKQLQSLIPFVQLPPSDA
VCEEYGLSTSRTPQNLFYVSGFISQCTHGAGRSATDRQFFFINQRPCDPA
KVSKLVNEVYHMYNRHQYPFVVLNVSVDSECVDINVTPDKRQILLQEEKL
LLAVLKTSLIGMFDSDANKLNVNQQPLLDVEGNLVKLHTAELEKPVPGKQ
DNSPSLKSTADEKRVASISRLREAFSLHPTKEIKSRGPETAELTRSFPSE
KRGVLSSYPSDVISYRGLRGSQDKLVSPTDSPGDCMDREKIEKDSGLSST
SAGSEEGFSTPEVASSFSSDYNVSSPEDRPSQETINCGDLDCRPPGTGQS
LKPEDHGYQCKALPLARLSPTNAKRFKTEERPSNVNISQRLPGPQSTSAA
EVDVAIKMNKRIVLLEFSLSSLAKRMKQLQHLKAQNKHELSYRKFRAKIC
PGENQAAEDELRKEISKSMFAEMEILGQFNLGFIVTKLKEDLFLVDQHAA
DEKYNFEMLQQHTVLQAQRLITPQTLNLTAVNEAVLIENLEIFRKNGFDF
VIDEDAPVTERAKLISLPTSKNWTFGPQDIDELIFMLSDSPGVMCRPSRV
RQMFASRACRKSVMIGTALNASEMKKLITHMGEMDHPWNCPHGRPTMRHV
ANLDVISQN

Pms2 (Mus musculus) belongs to following protein families:
References:

Title Authors Journal
Male mice defective in the DNA mismatch repair gene PMS2 exhibit abnormal chromosome synapsis in meiosis. Baker SM, Bronner CE, Zhang L, Plug AW, Robatzek M, Warren G, Elliott EA, Yu J, Ashley T, Arnheim N, Flavell RA, Liskay RM Cell July 28, 1995
Protein phosphorylation and expression profiling by Yin-yang multidimensional liquid chromatography (Yin-yang MDLC) mass spectrometry. Dai J, Jin WH, Sheng QH, Shieh CH, Wu JR, Zeng R J Proteome Res Feb. 1, 2007


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.