Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Dpb2p

Protein FULL name:

DNA polymerase epsilon subunit B, DNA polymerase II subunit 2


Dpb2p (Saccharomyces cerevisiae) is product of expression of DPB2 gene.


Dpb2p is involved in:

MMR in Saccharomyces cerevisiae
     
BER in Saccharomyces cerevisiae
     
HRR in Saccharomyces cerevisiae
     
NER in Saccharomyces cerevisiae
     


Keywords:



FUNCTION: DNA polymerase epsilon (DNA polymerase II) participates in chromosomal DNA replication. It is required during synthesis of the leading and lagging DNA strands at the replication fork and binds at/or near replication origins and moves along DNA with the replication fork. It has 3'-5' proofreading exonuclease activity that correct errors arising during DNA replication. It is also involved in DNA synthesis during DNA repair.

CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).

SUBUNIT: DNA polymerase epsilon is a heterotetramer consisting of POL2, DPB2, DPB3 and DPB4.

SUBCELLULAR LOCATION: Cytoplasm. Nucleus.

PTM: Phosphorylated in a cell cycle dependent manner during late G1 phase. Phosphorylation may facilitate the interaction with POL2 or the activity of DNA polymerase II. Phosphorylation is independent of DNA replication but dependent upon CDC28 in vivo. Both Ser-141 and Ser-613 are phosphorylated in vivo, but in vitro only Ser-141 is phosphorylated by CDC28.

MISCELLANEOUS: Present with 3110 +/- 251 molecules/cell in log phase SD medium.

MISCELLANEOUS: In eukaryotes there are five DNA polymerases: alpha, beta, gamma, delta, and epsilon which are responsible for different reactions of DNA synthesis.

SIMILARITY: Belongs to the DNA polymerase epsilon subunit B family.

SEQUENCE CAUTION: Sequence=AAA34576.1; Type=Erroneous initiation; Sequence=AAB68109.1; Type=Erroneous initiation;


NCBI GenPept GI number(s): 85681935
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P24482 P24482
PFAM: PF04042
PF04042
InterPro: IPR007185
IPR007185
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MFGSGNVLPVKIQPPLLRPLAYRVLSRKYGLSIKSDGLSALAEFVGTNIG
ANWRQGPATIKFLEQFAAVWKQQERGLFIDQSGVKEVIQEMKEREKVEWS
HEHPIQHEENILGRTDDDENNSDDEMPIAADSSLQNVSLSSPMRQPTERD
EYKQPFKPESSKALDWRDYFKVINASQQQRFSYNPHKMQFIFVPNKKQNG
LGGIAGFLPDIEDKVQMFLTRYYLTNDRVMRNENFQNSDMFNPLSSMVSL
QNELSNTNRQQQSSSMSITPIKNLLGRDAQNFLLLGLLNKNFKGNWSLED
PSGSVEIDISQTIPTQGHYYVPGCMVLVEGIYYSVGNKFHVTSMTLPPGE
RREITLETIGNLDLLGIHGISNNNFIARLDKDLKIRLHLLEKELTDHKFV
ILGANLFLDDLKIMTALSKILQKLNDDPPTLLIWQGSFTSVPVFASMSSR
NISSSTQFKNNFDALATLLSRFDNLTENTTMIFIPGPNDLWGSMVSLGAS
GTLPQDPIPSAFTKKINKVCKNVVWSSNPTRIAYLSQEIVIFRDDLSGRF
KRHRLEFPFNESEDVYTENDNMMSKDTDIVPIDELVKEPDQLPQKVQETR
KLVKTILDQGHLSPFLDSLRPISWDLDHTLTLCPIPSTMVLCDTTSAQFD
LTYNGCKVINPGSFIHNRRARYMEYVPSSKKTIQEEIYI

Dpb2p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
DPB2, the gene encoding DNA polymerase II subunit B, is required for chromosome replication in Saccharomyces cerevisiae. Araki H, Hamatake RK, Johnston LH, Sugino A Proc Natl Acad Sci U S A June 1, 1991
The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI. Bussey H, Storms RK, Ahmed A, Albermann K, Allen E, Ansorge W, Araujo R, Aparicio A, Barrell B, Badcock K, Benes V, Botstein D, Bowman S, Bruckner M, Carpenter J, Cherry JM, Chung E, Churcher C, Coster F, Davis K, Davis RW, Dietrich FS, Delius H, DiPaolo T, Hani J, et al. Nature May 1, 1997
Structure and function of the fourth subunit (Dpb4p) of DNA polymerase epsilon in Saccharomyces cerevisiae. Ohya T, Maki S, Kawasaki Y, Sugino A Nucleic Acids Res Oct. 15, 2000
Fidelity of DNA polymerase epsilon holoenzyme from budding yeast Saccharomyces cerevisiae. Shimizu K, Hashimoto K, Kirchner JM, Nakai W, Nishikawa H, Resnick MA, Sugino A J Biol Chem Oct. 4, 2002
The quaternary structure of DNA polymerase epsilon from Saccharomyces cerevisiae. Chilkova O, Jonsson BH, Johansson E J Biol Chem April 18, 2003
Sequencing and comparison of yeast species to identify genes and regulatory elements. Kellis M, Patterson N, Endrizzi M, Birren B, Lander ES Nature May 15, 2003
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature Oct. 16, 2003
Cell cycle-dependent phosphorylation of the DNA polymerase epsilon subunit, Dpb2, by the Cdc28 cyclin-dependent protein kinase. Kesti T, McDonald WH, Yates JR 3rd, Wittenberg C J Biol Chem April 2, 2004


Last modification of this entry: Oct. 19, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.