Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RecJ

Protein FULL name:

single-stranded DNA-specific exonuclease [Escherichia coli].


RecJ (Escherichia coli strain K-12 substr. MG1655) is product of expression of recJ gene.


RecJ is involved in:

HRR in Escherichia coli strain K-12 substr. MG1655
     
MMR in Escherichia coli strain K-12 substr. MG1655 BER in Escherichia coli strain K-12 substr. MG1655
     





FUNCTION: Single-stranded-DNA-specific exonuclease. Required for many types of recombinational events, although the stringency of the requirement for recJ appears to vary with the type of recombinational event monitored and the other recombination gene products which are available.

INTERACTION: P76298:flhA; NbExp=1; IntAct=EBI-556893, EBI-1130699;

SIMILARITY: Belongs to the recJ family.


NCBI GenPept GI number(s): 887842
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P21893 P21893
PFAM: - P21893 (Link - using uniprot id)
InterPro: - P21893 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MKQQIQLRRREVDETADLPAELPPLLRRLYASRGVRSAQELERSVKGMLP
WQQLSGVEKAVEILYNAFREGTRIIVVGDFDADGATSTALSVLAMRSLGC
SNIDYLVPNRFEDGYGLSPEVVDQAHARGAQLIVTVDNGISSHAGVEHAR
SLGIPVIVTDHHLPGDTLPAAEAIINPNLRDCNFPSKSLAGVGVAFYLML
ALRTFLRDQGWFDERNIAIPNLAELLDLVALGTVADVVPLDANNRILTWQ
GMSRIRAGKCRPGIKALLEVANRDAQKLAASDLGFALGPRLNAAGRLDDM
SVGVALLLCDNIGEARVLANELDALNQTRKEIEQGMQIEALTLCEKLERS
RDTLPGGLAMYHPEWHQGVVGILASRIKERFHRPVIAFAPAGDGTLKGSG
RSIQGLHMRDALERLDTLYPGMMLKFGGHAMAAGLSLEEDKFKLFQQRFG
ELVTEWLDPSLLQGEVVSDGPLSPAEMTMEVAQLLRDAGPWGQMFPEPLF
DGHFRLLQQRLVGERHLKVMVEPVGGGPLLDGIAFNVDTALWPDNGVREV
QLAYKLDINEFRGNRSLQIIIDNIWPI


Last modification of this entry: Oct. 8, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.