Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

AlkB

Protein FULL name:

alkB [Escherichia coli].


AlkB (Escherichia coli strain K-12 substr. MG1655) is product of expression of alkB gene.


AlkB is involved in:

DRR in Escherichia coli strain K-12 substr. MG1655
     


Keywords:



FUNCTION: Dioxygenase that repairs alkylated DNA and RNA containing 3-methylcytosine or 1-methyladenine by oxidative demethylation. Has highest activity towards 3-methylcytosine. Has lower activity towards alkylated DNA containing ethenoadenine, and no detectable activity towards 1-methylguanine or 3-methylthymine. Accepts double-stranded and single-stranded substrates. Requires molecular oxygen, alpha-ketoglutarate and iron. Provides extensive resistance to alkylating agents such as MMS and DMS (SN2 agents), but not to MMNG and MNU (SN1 agents).

COFACTOR: Binds 1 Fe(2+) ion per subunit.

SIMILARITY: Belongs to the alkB family.

SIMILARITY: Contains 1 Fe2OG dioxygenase domain.


NCBI GenPept GI number(s): 405945
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P05050 P05050
PFAM: - P05050 (Link - using uniprot id)
InterPro: - P05050 (Link - using uniprot id)
CATH: None  
SCOP: None  
PDB: - -


Protein sequence:
MLDLFADAEPWQEPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMV
TPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLC
QRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGL
PAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLT
IDCRYNLTFRQAGKKE

AlkB (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
References:

Title Authors Journal
Active site and complete sequence of the suicidal methyltransferase that counters alkylation mutagenesis. Demple B, Sedgwick B, Robins P, Totty N, Waterfield MD, Lindahl T Proc Natl Acad Sci U S A May 1, 1985
Structure and expression of the alkB gene of Escherichia coli related to the repair of alkylated DNA. Kondo H, Nakabeppu Y, Kataoka H, Kuhara S, Kawabata S, Sekiguchi M J Biol Chem Nov. 25, 1986
The Escherichia coli AlkB protein protects human cells against alkylation-induced toxicity. Chen BJ, Carroll P, Samson L J Bacteriol Oct. 1, 1994
A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map. Itoh T, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Kasai H, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Seki Y, Horiuchi T, et al. DNA Res Dec. 31, 1996
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Human and bacterial oxidative demethylases repair alkylation damage in both RNA and DNA. Aas PA, Otterlei M, Falnes PO, Vagbo CB, Skorpen F, Akbari M, Sundheim O, Bjoras M, Slupphaug G, Seeberg E, Krokan HE Nature Jan. 20, 2003
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006
Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB. Yu B, Edstrom WC, Benach J, Hamuro Y, Weber PC, Gibney BR, Hunt JF Nature Jan. 16, 2006
Crystal structures of DNA/RNA repair enzymes AlkB and ABH2 bound to dsDNA. Yang CG, Yi C, Duguid EM, Sullivan CT, Jian X, Rice PA, He C Nature April 24, 2008
Enzymological and structural studies of the mechanism of promiscuous substrate recognition by the oxidative DNA repair enzyme AlkB. Yu B, Hunt JF Proc Natl Acad Sci U S A Aug. 25, 2009


Last modification of this entry: July 7, 2011.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.