Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Tel1p

Protein FULL name:

Protein kinase primarily involved in telomere length regulation; contributes to cell cycle checkpoint control in response to DNA damage; functionally redundant with Mec1p; homolog of human ataxia telangiectasia (ATM) gene


Tel1p (Saccharomyces cerevisiae) is product of expression of TEL1 gene.



Keywords:



FUNCTION: Serine/threonine protein kinase which activates checkpoint signaling upon genotoxic stresses such as ionizing radiation (IR), ultraviolet light (UV), or DNA replication stalling, thereby acting as a DNA damage sensor. Recognizes the substrate consensus sequence [ST]-Q. Recruited by the MRX-complex to sites of DNA lesions immediately after damage to initiate non- homologous end-joining (NHEJ). Subsequently displaced by the RPA complex in a reaction probably involving the SAE2 protein. Phosphorylates MRE11 and XRS2, 2 subunits of the MRX-complex. The phosphorylation of MRE11 is a feedback response from the checkpoint signaling pathway. Phosphorylates RAD9, CHK1 and RAD53, leading to the activation of the CHK1 and RAD23 kinases involved in the DNA damage response cascade. Phosphorylates histone H2A to form H2AS128ph (gamma-H2A) at sites of DNA damage, also involved in the regulation of DNA damage response mechanism. Phosphorylates also SLX4 and RTT107 which are involved in genome stability. Required for the control of telomere length and genome stability.

CATALYTIC ACTIVITY: ATP + a protein = ADP + a phosphoprotein.

SUBUNIT: Interacts with XRS2 and associates with DNA double-strand breaks.

INTERACTION: Q02979:GDE1; NbExp=1; IntAct=EBI-19099, EBI-31287;

SUBCELLULAR LOCATION: Nucleus. Telomere. Note=Localizes to nuclear DNA repair foci in response to DNA double strand breaks.

SIMILARITY: Belongs to the PI3/PI4-kinase family. ATM subfamily.

SIMILARITY: Contains 1 FAT domain.

SIMILARITY: Contains 1 FATC domain.

SIMILARITY: Contains 1 PI3K/PI4K domain.


NCBI GenPept GI number(s): 6319383
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P38110 P38110
PFAM: - P38110 (Link - using uniprot id)
InterPro: - P38110 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MEDHGIVETLNFLSSTKIKERNNALDELTTILKEDPERIPTKALSTTAEA
LVELLASEHTKYCDLLRNLTVSTTNKLSLSENRLSTISYVLRLFVEKSCE
RFKVKTLKLLLAVVPELMVKDGSKSLLDAVSVHLSFALDALIKSDPFKLK
FMIHQWISLVDKICEYFQSQMKLSMVDKTLTNFISILLNLLALDTVGIFQ
VTRTITWTVIDFLRLSKKENGNTRLIMSLINQLILKCHCFSVIDTLMLIK
EAWSYNLTIGCTSNELVQDQLSLFDVMSSELMNHKLPYMIGQENYVEELR
SESLVSLYREYILLRLSNYKPQLFTVNHVEFSYIRGSRDKNSWFALPDFR
LRDRGGRSVWLKILGITKSLLTYFALNRKNENYSLLFKRRKCDSDIPSIL
RISDDMDTFLIHLLEENSSHEFEVLGLQLCSFYGTLQDFTKSFAEQLKEL
LFSKFEKIQCFNWVCFSFIPLLSQKECELSNGDMARLFKVCLPLVKSNES
CQLSCLLLANSIKFSKQLLSDEKTINQIYDLYELSDILGPILVTNESFML
WGYLQYVGKDFQSMNGISSADRIFEWLKSKWNQLRGTDAKQDQFCNFISW
LGNKYDPENPFNDKKGEGANPVSLCWDESHKIWQHFQEQREFLLGVKPEE
KSECFNTPFFNLPKVSLDLTRYNEILYRLLENIESDAFSSPLQKFTWVAK
LIQIVDNLCGDSTFSEFIAAYKRTTLITIPQLSFDSQNSYQSFFEEVLSI
RTINVDHLVLDKINMKEIVNDFIRMQKNKSQTGTSAINYFEASSEDTTQN
NSPYTIGGRFQKPLHSTIDKAVRAYLWSSRNKSISERLVAILEFSDCVST
DVFISYLGTVCQWLKQAIGEKSSYNKILEEFTEVLGEKLLCNHYSSSNQA
MLLLTSYIEAIRPQWLSYPEQPLNSDCNDILDWIISRFEDNSFTGVAPTV
NLSMLLLSLLQNHDLSHGSIRGGKQRVFATFIKCLQKLDSSNIINIMNSI
SSYMAQVSYKNQSIIFYEIKSLFGPPQQSIEKSAFYSLAMSMLSLVSYPS
LVFSLEDMMTYSGFNHTRAFIQQALNKITVAFRYQNLTELFEYCKFDLIM
YWFNRTKVPTSKLEKEWDISLFGFADIHEFLGRYFVEISAIYFSQGFNQK
WILDMLHAITGNGDAYLVDNSYYLCIPLAFISGGVNELIFDILPQISGKT
TVKYHKKYRLLMLKWIIRFTDLGSLTELRSTVEKLFPTSYLSPYLFENSS
VSMRYQYPLHIPLALGATLVQTQFAHEKNNTHEFKLLFLSVITDLEKTST
YIGKLRCARELKYLFVLYENVLVKSSTLNFIIIRLSKFLIDTQIHDEVIT
IFSSLLNLADKNTFEIEPSLPNLFCKIFIYLRENKQLSPSFQQAIKLLEH
RDLIKIKTWKYFLDAIFGNIVQDDIYENTELLDASDCGVDDVVLVSLLFS
YARRPVASKIGCSLSKAAAINILKHHVPKEYLSKNFKLWFAALSRRILQQ
EVQRERSTNFNNEVHLKNFEMVFRHPEQPHMIYQRISTFNKEAELYDSTE
VFFISECILTYLVGYSIGNSESEFCFRDNIMNENKDKVAPLDKDVLNAIY
PLANNFGMESFICDTYLSVNEPYNCWLSKFARSLIHQISFNIPPIVCLYP
LCKGSTAFCELVLTDLFFLSTTYDPKSCLNWSNRIFTQIAMLLHVKDSEI
KLKMLFNVIKMIRMGSRCKERNCLRIYSSLDLQEICQISLKIKEFKFGYL
LFEEMNMPNIREMNINTLQKIYECINDGDFLAGLPVPHSIEGVLNSINRI
DSDTWKRFLFNNADFDANYTTSLEEEKESLIKATEDSGFYGLTSLLESRL
SGSSDVYKWNLELGDWKLLTPKVVDSKAKGLYYAIKNLPQDVGFAEKSLE
KSLLTIFDSRQHFISQTEWMDTLNAIIEFIKIAAIPQDVTSFPQTLMSIM
KADKERLNTIDFYDHKTTLKSRHTLMNVLSRNSLDENVKCSKYLRLGSII
QLANYVQLAIANGAPQDALRNATLMSKTVKNIAKLYDDPSVVSQIEKLAS
FTSANALWESREYKAPVMIMRDLLAQNEKNISESILYDDFKLLINVPMDQ
IKARLVKWSSESRLEPAAAIYEKIIVNWDINVEDHESCSDVFYTLGSFLD
EQAQKLRSNGEIEDREHRSYTGKSTLKALELIYKNTKLPENERKDAKRHY
NRVLLQYNRDSEVLKALLLQKEKFLWHALHFYLNTLVFSNRYDNDIIDKF
CGLWFENDDNSKINQLLYKEIGTIPSWKFLPWVNQIASKISMEENEFQKP
LQLTMKRLLYKLPYDSLYSVMSILLYEKQSNKDTNISQKIQAVKKILLEL
QGYDRGAFAKKYLLPVQEFCEMSVELANLKFVQNTKTLRLANLKIGQYWL
KQLNMEKLPLPTSNFTVKSSADGRKARPYIVSVNETVGITTTGLSLPKIV
TFNISDGTTQKALMKGSNDDLRQDAIMEQVFQQVNKVLQNDKVLRNLDLG
IRTYKVVPLGPKAGIIEFVANSTSLHQILSKLHTNDKITFDQARKGMKAV
QTKSNEERLKAYLKITNEIKPQLRNFFFDSFPDPLDWFEAKKTYTKGVAA
SSIVGYILGLGDRHLNNILLDCSTGEPIHIDLGIAFDQGKLLPIPELVPF
RLTRDIVDGFGVTGVDGLFRRSCERVYAVLRKDYVKVMCVLNILKWDPLY
SWVMSPVKKYEHLFEEEHEITNFDNVSKFISNNDRNENQESYRALKGVEE
KLMGNGLSVESSVQDLIQQATDPSNLSVIYMGWSPFY

Tel1p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Complete DNA sequence of yeast chromosome II. Feldmann H, Aigle M, Aljinovic G, Andre B, Baclet MC, Barthe C, Baur A, Becam AM, Biteau N, Boles E, et al. EMBO J Dec. 15, 1994
TEL1, a gene involved in controlling telomere length in S. cerevisiae, is homologous to the human ataxia telangiectasia gene. Greenwell PW, Kronmal SL, Porter SE, Gassenhuber J, Obermaier B, Petes TD Cell Sept. 8, 1995
Sequence analysis of a 78.6 kb segment of the left end of Saccharomyces cerevisiae chromosome II. Obermaier B, Gassenhuber J, Piravandi E, Domdey H Yeast Sept. 15, 1995
Regulation of RAD53 by the ATM-like kinases MEC1 and TEL1 in yeast cell cycle checkpoint pathways. Sanchez Y, Desany BA, Jones WJ, Liu Q, Wang B, Elledge SJ Science Feb. 19, 1996
Protein kinase activity of Tel1p and Mec1p, two Saccharomyces cerevisiae proteins related to the human ATM protein kinase. Mallory JC, Petes TD Proc Natl Acad Sci U S A Dec. 5, 2000
Suppression of spontaneous chromosomal rearrangements by S phase checkpoint functions in Saccharomyces cerevisiae. Myung K, Datta A, Kolodner RD Cell Jan. 9, 2001
A DNA damage response pathway controlled by Tel1 and the Mre11 complex. Usui T, Ogawa H, Petrini JH Mol Cell June 1, 2001
The yeast Xrs2 complex functions in S phase checkpoint regulation. D'Amours D, Jackson SP Genes Dev Sept. 1, 2001
Hyperactivation of the yeast DNA damage checkpoint by TEL1 and DDC2 overexpression. Clerici M, Paciotti V, Baldo V, Romano M, Lucchini G, Longhese MP EMBO J Nov. 15, 2001
Lcd1p recruits Mec1p to DNA lesions in vitro and in vivo. Rouse J, Jackson SP Mol Cell April 1, 2002
Yeast histone 2A serine 129 is essential for the efficient repair of checkpoint-blind DNA damage. Redon C, Pilch DR, Rogakou EP, Orr AH, Lowndes NF, Bonner WM EMBO Rep July 1, 2003
ATM-related Tel1 associates with double-strand breaks through an Xrs2-dependent mechanism. Nakada D, Matsumoto K, Sugimoto K Genes Dev Aug. 15, 2003
Choreography of the DNA damage response: spatiotemporal relationships among checkpoint and repair proteins. Lisby M, Barlow JH, Burgess RC, Rothstein R Cell Sept. 17, 2004
Distribution and dynamics of chromatin modification induced by a defined DNA double-strand break. Shroff R, Arbel-Eden A, Pilch D, Ira G, Bonner WM, Petrini JH, Haber JE, Lichten M Curr Biol Oct. 5, 2004
Slx4 becomes phosphorylated after DNA damage in a Mec1/Tel1-dependent manner and is required for repair of DNA alkylation damage. Flott S, Rouse J Biochem J Oct. 15, 2005
A mutation in yeast Tel1p that causes differential effects on the DNA damage checkpoint and telomere maintenance. Chakhparonian M, Faucher D, Wellinger RJ Curr Genet Nov. 1, 2005


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.