Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Rad28p

Protein FULL name:

Protein involved in DNA repair, related to the human CSA protein that is involved in transcription-coupled repair nucleotide excision repair


Rad28p (Saccharomyces cerevisiae) is product of expression of RAD28 gene.


Rad28p is involved in:

NER in Saccharomyces cerevisiae

Keywords:



FUNCTION: Involved in transcription-coupled repair nucleotide excision repair (NER) of UV-induced DNA lesions.

SUBCELLULAR LOCATION: Nucleus (Probable).

SIMILARITY: Contains 5 WD repeats.


NCBI GenPept GI number(s): 6320233
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q12021 Q12021
PFAM: - Q12021 (Link - using uniprot id)
InterPro: - Q12021 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MDPFLEFRVGNISLNEFYRRTIQSEFERILEDPLSNMKNYRFSKQSNYST
KEKTPLSIGVNCLDIDDTGQVLLGGGDDGSLSIWGLDESLHRNDEGEQEL
INKRLNYIKRQPHQSDDEPAQIMGYKNKRTRINDNNTMRLVHSFQTQRNK
YRMYRQSSAAVPVQRSHISNKTDSPIGFSETLSETDSEASISHHKYGITT
LKWYKADNGMFFTGSNDKTVKIWDTNRFEAVQDINLGYKINQIDNNVVDD
SSLLVVASEDYYPRLIDLRTMNSGVTALGMGNQTRMQSEILCCKFNPVRE
QIIACGDMEGGVKLWDLRMRNRLYSELKRNKNRFKTINNDDNDDQSDVYF
SSNQSKAHLRCCSDIVWNSEGSELCSVGMDGKLNVWRPFTEILQPEGLAS
YSQLGTQDLSRIKYKKRVSRRLLWFDKFLLCITDNGEVEIYNTEEKKLWN
KLEYPMVNQVKKNQASHCQFSSMIVQTNIMNSVGLKLFFGTNNNTVSDGG
SIFECS

Rad28p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Molecular cloning and characterization of Saccharomyces cerevisiae RAD28, the yeast homolog of the human Cockayne syndrome A (CSA) gene. Bhatia PK, Verhage RA, Brouwer J, Friedberg EC J Bacteriol Oct. 1, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. Nature May 1, 1997
Recovery of RNA polymerase II synthesis following DNA damage in mutants of Saccharomyces cerevisiae defective in nucleotide excision repair. Reagan MS, Friedberg EC Nucleic Acids Res Nov. 1, 1997


Last modification of this entry: Oct. 19, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.