Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Cdc9p

Protein FULL name:

DNA ligase


Protein SHORT name:

MMS8


Cdc9p (Saccharomyces cerevisiae) is product of expression of CDC9 gene.


Cdc9p is involved in:

BER in Saccharomyces cerevisiae MMR in Saccharomyces cerevisiae NER in Saccharomyces cerevisiae

Keywords:



FUNCTION: DNA ligase that seals nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair. The mitochondrial form is required for mitochondrial DNA maintenance but is non-essential while the nuclear form is essential for cell viability.

CATALYTIC ACTIVITY: ATP + (deoxyribonucleotide)(n) + (deoxyribonucleotide)(m) = AMP + diphosphate + (deoxyribonucleotide)(n+m).

COFACTOR: Magnesium (By similarity).

INTERACTION: P15891:ABP1; NbExp=1; IntAct=EBI-5991, EBI-2036; P20449:DBP5; NbExp=1; IntAct=EBI-1009737, EBI-5617; P36156:ECM4; NbExp=1; IntAct=EBI-1009737, EBI-2042717;

SUBCELLULAR LOCATION: Nucleus. Mitochondrion.

MISCELLANEOUS: Cdc9 is included within the category of so-called 'start genes', encoding proteins which are required in early G1, when the cell is faced with the option of initiating a further cell cycle.

MISCELLANEOUS: Present with 149 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the ATP-dependent DNA ligase family.


NCBI GenPept GI number(s): 6320038
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P04819 P04819
PFAM: - P04819 (Link - using uniprot id)
InterPro: - P04819 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MRRLLTGCLLSSARPLKSRLPLLMSSSLPSSAGKKPKQATLARFFTSMKN
KPTEGTPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSM
GSNFSSIPSSAPSSGVADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYSE
VCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPD
YEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQ
PTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAK
FLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESA
QQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTK
AINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYP
EINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELN
DVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQI
TTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD
YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGT
GFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTAD
LSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQ
SHMQN

Cdc9p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
The nucleotide sequence of the DNA ligase gene (CDC9) from Saccharomyces cerevisiae: a gene which is cell-cycle regulated and induced in response to DNA damage. Barker DG, White JH, Johnston LH Nucleic Acids Res Dec. 9, 1985
Molecular structure and genetic regulation of SFA, a gene responsible for resistance to formaldehyde in Saccharomyces cerevisiae, and characterization of its protein product. Wehner EP, Rao E, Brendel M Mol Gen Genet March 1, 1993
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. Nature May 1, 1997
The yeast CDC9 gene encodes both a nuclear and a mitochondrial form of DNA ligase I. Willer M, Rainey M, Pullen T, Stirling CJ Curr Biol Oct. 7, 1999
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry. Chi A, Huttenhower C, Geer LY, Coon JJ, Syka JE, Bai DL, Shabanowitz J, Burke DJ, Troyanskaya OG, Hunt DF Proc Natl Acad Sci U S A Jan. 13, 2007
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res April 1, 2007
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A June 19, 2007
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics July 1, 2008


Last modification of this entry: Oct. 19, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.