Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ccl1p

Ccl1p (Saccharomyces cerevisiae) is product of expression of CCL1 gene.


Ccl1p is involved in:

NER in Saccharomyces cerevisiae
     


Keywords:



FUNCTION: Regulatory component of the TFIIK complex (KIN28-CCL1 dimer) which is the protein kinase component of transcription factor IIH (TFIIH) and phosphorylates the C-terminal domain of RNA polymerase II during transition from transcription to elongation after preinitiation complex (PIC) formation, thereby positively regulating transcription. TFIIH (or factor B) is essential for both basal and activated transcription, and is involved in nucleotide excision repair (NER) of damaged DNA. TFIIH has DNA- dependent ATPase activity and is essential for polymerase II transcription in vitro.

SUBUNIT: CCL1 and KIN28 form the TFIIK complex, a component of TFIIH holo complex. Component of a complex consisting of KIN28, CCL1 and TFB3.

INTERACTION: P17157:PHO85; NbExp=1; IntAct=EBI-4385, EBI-13327; Q03290:TFB3; NbExp=1; IntAct=EBI-4385, EBI-31406;

MISCELLANEOUS: Present with 8700 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the cyclin family. Cyclin C subfamily.


This protein can be a part of a given complexes:
NCBI GenPept GI number(s): 6325282
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P37366 P37366
PFAM: - P37366 (Link - using uniprot id)
InterPro: - P37366 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MTDIQLNGKSTLDTPSATMSAKEKEAKLKSADENNKPPNYKRISDDDLYR
HSSQYRMWSYTKDQLQEKRVDTNARAIAYIEENLLKFREAHNLTEEEIKV
LEAKAIPLTMEEELDLVNFYAKKVQVIAQHLNLPTEVVATAISFFRRFFL
ENSVMQIDPKSIVHTTIFLACKSENYFISVDSFAQKAKSTRDSVLKFEFK
LLESLKFSLLNHHPYKPLHGFFLDIQNVLYGKVDLNYMGQIYDRCKKRIT
AALLTDVVYFYTPPQITLATLLIEDEALVTRYLETKFPSREGSQESVPGN
EKEEPQNDASTTEKNKEKSTESEEYSIDSAKLLTIIRECKSIIEDCKPPS
TEEAKKIAAKNYYCQNPSTLIQKLKRKLNGEDTSSTVEKKQKT

Ccl1p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
The kin28 protein kinase is associated with a cyclin in Saccharomyces cerevisiae. Valay JG, Simon M, Faye G J Mol Biol Nov. 20, 1993
The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI. Bussey H, Storms RK, Ahmed A, Albermann K, Allen E, Ansorge W, Araujo R, Aparicio A, Barrell B, Badcock K, Benes V, Botstein D, Bowman S, Bruckner M, Carpenter J, Cherry JM, Chung E, Churcher C, Coster F, Davis K, Davis RW, Dietrich FS, Delius H, DiPaolo T, Hani J, et al. Nature May 1, 1997
Genes for Tfb2, Tfb3, and Tfb4 subunits of yeast transcription/repair factor IIH. Homology to human cyclin-dependent kinase activating kinase and IIH subunits. Feaver WJ, Henry NL, Wang Z, Wu X, Svejstrup JQ, Bushnell DA, Friedberg EC, Kornberg RD J Biol Chem Aug. 1, 1997
Kin28 is found within TFIIH and a Kin28-Ccl1-Tfb3 trimer complex with differential sensitivities to T-loop phosphorylation. Keogh MC, Cho EJ, Podolny V, Buratowski S Mol Cell Biol March 1, 2002
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003


Last modification of this entry: Oct. 19, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.