REPAIRtoire - a database of DNA repair pathways

Welcome! Click here to login or here to register.

Home

Bujnicki Lab Homepage

Yku70p

Protein FULL name:

Subunit of the telomeric Ku complex (Yku70p-Yku80p), involved in telomere length maintenance, structure and telomere position effect; relocates to sites of double-strand cleavage to promote nonhomologous end joining during DSB repair

Yku70p (Saccharomyces cerevisiae) is product of expression of YKU70 gene.

Yku70p is involved in:

NHEJ in Saccharomyces cerevisiae

Keywords:

non-homologues end-joining (NHEJ)

FUNCTION: Single stranded DNA-dependent ATP-dependent helicase. Involved in non-homologous end joining (NHEJ) DNA double strand break repair. DNA-binding is sequence-independent but has a high affinity to nicks in double stranded DNA and to the ends of duplex DNA. Binds to naturally occurring chromosomal ends, and therefore provides chromosomal end protection. Appears to have a role in recruitment of telomerase and CDC13 to the telomere and the subsequent telomere elongation. Required also for telomere recombination to repair telomeric ends in the absence of telomerase. KU70, of the KU70/KU80 heterodimer, binds to the stem loop of TLC1, the RNA component of telomerase. Involved in telomere maintenance. Interacts with telomeric repeats and subtelomeric sequences thereby controlling telomere length and protecting against subtelomeric rearrangement. Maintains telomeric chromatin, which is involved in silencing the expression of genes located at the telomere. Required for mating-type switching.

CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.

SUBUNIT: Heterodimer of YKU70/HDF1 and YKU80/HDF2.

INTERACTION: Q04437:YKU80; NbExp=1; IntAct=EBI-8214, EBI-8224;

SUBCELLULAR LOCATION: Nucleus. Telomere.

PTM: Sumoylated by MMS21.

MISCELLANEOUS: Present with 892 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the ku70 family.

SIMILARITY: Contains 1 Ku domain.

NCBI GenPept GI number(s):	6323940
Species:	Saccharomyces cerevisiae

Links to other databases:

Database	ID	Link
Uniprot	P32807	P32807
PFAM:	-	P32807 (Link - using uniprot id)
InterPro:	-	P32807 (Link - using uniprot id)
CATH:	-	-
SCOP:	-	-
PDB:	-	-

Protein sequence:

MRSVTNAFGNSGELNDQVDETGYRKFDIHEGILFCIELSETMFKESSDLE
YKSPLLEILESLDELMSQLVITRPGTAIGCYFYYCNREDAKEGIYELFPL
RDINATFMKKLNDLLEDLSSGRISLYDYFMFQQTGSEKQVRLSVLFTFML
DTFLEEIPGQKQLSNKRVFLFTDIDKPQEAQDIDERARLRRLTIDLFDNK
VNFATFFIGYADKPFDNEFYSDILQLGSHTNENTGLDSEFDGPSTKPIDA
KYIKSRILRKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYK
LVYEHEDIRQEAYSKRKFLNPITGEDVTGKTVKVYPYGDLDINLSDSQDQ
IVMEAYTQKDAFLKIIGFRSSSKSIHYFNNIDKSSFIVPDEAKYEGSIRT
LASLLKILRKKDKIAILWGKLKSNSHPSLYTLSPSSVKDYNEGFYLYRVP
FLDEIRKFPSLLSYDDGSEHKLDYDNMKKVTQSIMGYFNLRDGYNPSDFK
NPLLQKHYKVLHDYLLQIETTFDENETPNTKKDRMMREDDSLRKLYYIRN
KILESEKSEDPIIQRLNKYVKIWNMFYKKFNDDNISIKEEKKPFDKKPKF
NI

Yku70p (Saccharomyces cerevisiae) belongs to following protein families:

fam50v00000011257

References:

Title	Authors	Journal
A putative homologue of the human autoantigen Ku from Saccharomyces cerevisiae.	Feldmann H, Winnacker EL	J Biol Chem June 15, 1993
Cloning and sequencing of the NES24 gene of Saccharomyces cerevisiae.	Yoshida M, Shimma Y, Uno I, Toh-e A	Yeast March 1, 1994
Involvement of the Saccharomyces cerevisiae HDF1 gene in DNA double-strand break repair and recombination.	Mages GJ, Feldmann HM, Winnacker EL	J Biol Chem April 5, 1996
Hdf1, a yeast Ku-protein homologue, is involved in illegitimate recombination, but not in homologous recombination.	Tsukamoto Y, Kato J, Ikeda H	Nucleic Acids Res June 1, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII.	Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B	Nature May 1, 1997
Mutation of yeast Ku genes disrupts the subnuclear organization of telomeres.	Laroche T, Martin SG, Gotta M, Gorham HC, Pryde FE, Louis EJ, Gasser SM	Curr Biol May 21, 1998
Telomere maintenance is dependent on activities required for end repair of double-strand breaks.	Nugent CI, Bosco G, Ross LO, Evans SK, Salinger AP, Moore JK, Haber JE, Lundblad V	Curr Biol May 21, 1998
The yeast Ku heterodimer is essential for protection of the telomere against nucleolytic and recombinational activities.	Polotnianka RM, Li J, Lustig AJ	Curr Biol July 2, 1998
Telomerase, Ku, and telomeric silencing in Saccharomyces cerevisiae.	Evans SK, Sistrunk ML, Nugent CI, Lundblad V	Chromosoma Dec. 1, 1998
The Saccharomyces cerevisiae DNA damage checkpoint is required for efficient repair of double strand breaks by non-homologous end joining.	de la Torre-Ruiz M, Lowndes NF	FEBS Lett Jan. 11, 2000
Cdc13 cooperates with the yeast Ku proteins and Stn1 to regulate telomerase recruitment.	Grandin N, Damon C, Charbonneau M	Mol Cell Biol Nov. 1, 2000
Involvement of replicative polymerases, Tel1p, Mec1p, Cdc13p, and the Ku complex in telomere-telomere recombination.	Tsai YL, Tseng SF, Chang SH, Lin CC, Teng SC	Mol Cell Biol Aug. 1, 2002
Ku interacts with telomerase RNA to promote telomere addition at native and broken chromosome ends.	Stellwagen AE, Haimberger ZW, Veatch JR, Gottschling DE	Genes Dev Oct. 1, 2003
Global analysis of protein expression in yeast.	Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS	Nature Oct. 16, 2003
The Ku heterodimer performs separable activities at double-strand breaks and chromosome termini.	Bertuch AA, Lundblad V	Mol Cell Biol Nov. 1, 2003
A SUMO ligase is part of a nuclear multiprotein complex that affects DNA repair and chromosomal organization.	Zhao X, Blobel G	Proc Natl Acad Sci U S A March 1, 2005
Sequence diversity, reproductive isolation and species concepts in Saccharomyces.	Liti G, Barton DB, Louis EJ	Genetics Oct. 1, 2006
Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry.	Chi A, Huttenhower C, Geer LY, Coon JJ, Syka JE, Bai DL, Shabanowitz J, Burke DJ, Troyanskaya OG, Hunt DF	Proc Natl Acad Sci U S A Jan. 13, 2007
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.	Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J	Genome Res April 1, 2007

Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.

Welcome stranger! Click here to login or here to register.