Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Apn2p

Protein FULL name:

apurinic/apyrimidinic (AP) lyase 2


Protein SHORT name:

APN2, ETH1


Apn2p (Saccharomyces cerevisiae) is product of expression of APN2 gene.


Apn2p is involved in:

BER in Saccharomyces cerevisiae

Keywords:



FUNCTION: DNA repair enzyme that cleaves apurinic/apyrimidinic (AP) sites and removes 3'-blocking groups present at single strand breaks of damaged DNA.

CATALYTIC ACTIVITY: The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate.

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: Present with 414 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the DNA repair enzymes AP/exoA family.


NCBI GenPept GI number(s): 6319452
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P38207 P38207
PFAM: - P38207 (Link - using uniprot id)
InterPro: - P38207 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSSSENTLLDGKSENTIRFLTFNVNGIRTFFHYQPFSQMNQSLRSVFDFF
RADIITFQELKTEKLSISKWGRVDGFYSFISIPQTRKGYSGVGCWIRIPE
KNHPLYHALQVVKAEEGITGYLTIKNGKHSAISYRNDVNQGIGGYDSLDP
DLDEKSALELDSEGRCVMVELACGIVIISVYCPANSNSSEEGEMFRLRFL
KVLLRRVRNLDKIGKKIVLMGDVNVCRDLIDSADTLEQFSIPITDPMGGT
KLEAQYRDKAIQFIINPDTPHRRIFNQILADSLLPDASKRGILIDTTRLI
QTRNRLKMYTVWNMLKNLRPSNYGSRIDFILVSLKLERCIKAADILPDIL
GSDHCPVYSDLDILDDRIEPGTTQVPIPKFEARYKYNLRNHNVLEMFAKK
DTNKESNKQKYCVSKVMNTKKNSNIKNKSLDSFFQKVNGEKDDRIKESSE
IPQQAKKRISTPKLNFKDVFGKPPLCRHGEESMLKTSKTSANPGRKFWIC
KRSRGDSNNTESSCGFFQWV

Apn2p (Saccharomyces cerevisiae) is able to recognize following damages:
Apn2p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Complete DNA sequence of yeast chromosome II. Feldmann H, Aigle M, Aljinovic G, Andre B, Baclet MC, Barthe C, Baur A, Becam AM, Biteau N, Boles E, et al. EMBO J Dec. 15, 1994
Identification of APN2, the Saccharomyces cerevisiae homolog of the major human AP endonuclease HAP1, and its role in the repair of abasic sites. Johnson RE, Torres-Ramos CA, Izumi T, Mitra S, Prakash S, Prakash L Genes Dev Oct. 1, 1998
Apurinic endonuclease activity of yeast Apn2 protein. Unk I, Haracska L, Johnson RE, Prakash S, Prakash L J Biol Chem July 21, 2000
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003


Last modification of this entry: Oct. 16, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.