Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Rad10p

Rad10p (Saccharomyces cerevisiae) is product of expression of RAD10 gene.


Rad10p is involved in:

NER in Saccharomyces cerevisiae

Keywords:



FUNCTION: Involved in nucleotide excision repair of DNA damaged with UV light, bulky adducts, or cross-linking agents. Along with RAD1 forms an endonuclease that specifically degrades single- stranded DNA.

SUBUNIT: Component of the nucleotide excision repair factor 1 (NEF1) complex consisting of RAD1, RAD10 and RAD14. Interacts with SAW1.

INTERACTION: P47017:LSM1; NbExp=1; IntAct=EBI-14637, EBI-174; P32266:MGM1; NbExp=1; IntAct=EBI-14637, EBI-10865; P06777:RAD1; NbExp=1; IntAct=EBI-14637, EBI-14752;

SUBCELLULAR LOCATION: Nucleus.

SIMILARITY: Belongs to the ERCC1/RAD10/SWI10 family.


NCBI GenPept GI number(s): 6323543
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P06838 P06838
PFAM: - P06838 (Link - using uniprot id)
InterPro: - P06838 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MNNTDPTSFESILAGVAKLRKEKSGADTTGSQSLEIDASKLQQQEPQTSR
RINSNQVINAFNQQKPEEWTDSKATDDYNRKRPFRSTRPGKTVLVNTTQK
ENPLLNHLKSTNWRYVSSTGINMIYYDYLVRGRSVLFLTLTYHKLYVDYI
SRRMQPLSRNENNILIFIVDDNNSEDTLNDITKLCMFNGFTLLLAFNFEQ
AAKYIEYLNL

Rad10p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Molecular cloning and characterization of the yeast RAD10 gene and expression of RAD10 protein in E. coli. Weiss WA, Friedberg EC EMBO J June 1, 1985
Nucleotide sequence of the RAD10 gene of Saccharomyces cerevisiae. Reynolds P, Prakash L, Dumais D, Perozzi G, Prakash S EMBO J Dec. 16, 1985
Yeast DNA repair and recombination proteins Rad1 and Rad10 constitute a single-stranded-DNA endonuclease. Tomkinson AE, Bardwell AJ, Bardwell L, Tappe NJ, Friedberg EC Nature April 1, 1993
Nucleotide excision repair in yeast is mediated by sequential assembly of repair factors and not by a pre-assembled repairosome. Guzder SN, Sung P, Prakash L, Prakash S J Biol Chem April 12, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII. Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B Nature May 1, 1997
Examining protein protein interactions using endogenously tagged yeast arrays: the cross-and-capture system. Suter B, Fetchko MJ, Imhof R, Graham CI, Stoffel-Studer I, Zbinden C, Raghavan M, Lopez L, Beneti L, Hort J, Fillingham J, Greenblatt JF, Giaever G, Nislow C, Stagljar I Genome Res Dec. 1, 2007


Last modification of this entry: Oct. 19, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.