Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Dnl4p

Protein FULL name:

DNA ligase required for nonhomologous end-joining (NHEJ), forms stable heterodimer with required cofactor Lif1p, interacts with Nej1p; involved in meiosis, not essential for vegetative growth


Dnl4p (Saccharomyces cerevisiae) is product of expression of DNL4 gene.


Dnl4p is involved in:

NHEJ in Saccharomyces cerevisiae

Keywords:



FUNCTION: Has minor DNA joining activity. Can act on oligo(PDT)/poly(rA) substrate.

CATALYTIC ACTIVITY: ATP + (deoxyribonucleotide)(n) + (deoxyribonucleotide)(m) = AMP + diphosphate + (deoxyribonucleotide)(n+m).

COFACTOR: Magnesium (By similarity).

SUBUNIT: Interacts with LIF1 via its BRCT domain. Interacts with POL4 in the DNL4-LIF1 complex.

INTERACTION: P53150:LIF1; NbExp=2; IntAct=EBI-5983, EBI-23865;

SUBCELLULAR LOCATION: Nucleus (Potential).

SIMILARITY: Belongs to the ATP-dependent DNA ligase family.

SIMILARITY: Contains 2 BRCT domains.

SEQUENCE CAUTION: Sequence=AAC49484.1; Type=Frameshift; Positions=408, 413; Note=Produces 2 separate ORFs; Sequence=AAC49485.1; Type=Frameshift; Positions=408, 413; Note=Produces 2 separate ORFs;


NCBI GenPept GI number(s): 6324578
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q08387 Q08387
PFAM: - Q08387 (Link - using uniprot id)
InterPro: - Q08387 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MISALDSIPEPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKY
YEIISNFVEMWRKTVGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYL
KLPKNSATEQRLKDWKQRVGKGGNLSSLLVEEIAKRRAEPSSKAITIDNV
NHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFVELKYFFDIVLKNR
VIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKV
GFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIK
FFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRV
ILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQR
KQYLNSILSPLKNIVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLKYYN
SSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGRDSGKKDSFMLGLLVLD
EEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQEEFK
EIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLD
NTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSY
QAERSQLGLIRKKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTE
DTGIRITRAELEKTIVEHGGKLIYNVILKRHSIGDVRLISCKTTTECKAL
IDRGYDILHPNWVLDCIAYKRLILIEPNYCFNVSQKMRAVAEKRVDCLGD
SFENDISETKLSSLYKSQLSLPPMGELEIDSEVRRFPLFLFSNRIAYVPR
RKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEVHE
KIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVVNY

Dnl4p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
The sequence of a 30 kb fragment on the left arm of chromosome XV from Saccharomyces cerevisiae reveals 15 open reading frames, five of which correspond to previously identified genes. Sterky F, Holmberg A, Pettersson B, Uhlen M Yeast Sept. 1, 1996
Two distinct DNA ligase activities in mitotic extracts of the yeast Saccharomyces cerevisiae. Ramos W, Tappe N, Talamantez J, Friedberg EC, Tomkinson AE Nucleic Acids Res April 15, 1997
The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. Nature May 1, 1997
Saccharomyces cerevisiae LIF1: a function involved in DNA double-strand break repair related to mammalian XRCC4. Herrmann G, Lindahl T, Schar P EMBO J July 15, 1998
A physical and functional interaction between yeast Pol4 and Dnl4-Lif1 links DNA synthesis and ligation in nonhomologous end joining. Tseng HM, Tomkinson AE J Biol Chem Nov. 22, 2002
Structure of an Xrcc4-DNA ligase IV yeast ortholog complex reveals a novel BRCT interaction mode. Dore AS, Furnham N, Davies OR, Sibanda BL, Chirgadze DY, Jackson SP, Pellegrini L, Blundell TL DNA Repair (Amst) March 7, 2006


Last modification of this entry: Oct. 16, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.