Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Dnl4p |
Protein FULL name:
DNA ligase required for nonhomologous end-joining (NHEJ), forms stable heterodimer with required cofactor Lif1p, interacts with Nej1p; involved in meiosis, not essential for vegetative growth
Dnl4p (Saccharomyces cerevisiae) is product of expression of DNL4 gene.
Dnl4p is involved in:
NHEJ in Saccharomyces cerevisiae
Keywords:
FUNCTION: Has minor DNA joining activity. Can act on oligo(PDT)/poly(rA) substrate.
CATALYTIC ACTIVITY: ATP + (deoxyribonucleotide)(n) + (deoxyribonucleotide)(m) = AMP + diphosphate + (deoxyribonucleotide)(n+m).
COFACTOR: Magnesium (By similarity).
SUBUNIT: Interacts with LIF1 via its BRCT domain. Interacts with POL4 in the DNL4-LIF1 complex.
INTERACTION: P53150:LIF1; NbExp=2; IntAct=EBI-5983, EBI-23865;
SUBCELLULAR LOCATION: Nucleus (Potential).
SIMILARITY: Belongs to the ATP-dependent DNA ligase family.
SIMILARITY: Contains 2 BRCT domains.
SEQUENCE CAUTION: Sequence=AAC49484.1; Type=Frameshift; Positions=408, 413; Note=Produces 2 separate ORFs; Sequence=AAC49485.1; Type=Frameshift; Positions=408, 413; Note=Produces 2 separate ORFs;
| NCBI GenPept GI number(s): |
6324578 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q08387 |
Q08387 |
| PFAM: | - |
Q08387 (Link - using uniprot id) |
| InterPro: | - |
Q08387 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MISALDSIPEPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKY YEIISNFVEMWRKTVGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYL KLPKNSATEQRLKDWKQRVGKGGNLSSLLVEEIAKRRAEPSSKAITIDNV NHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFVELKYFFDIVLKNR VIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKV GFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIK FFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRV ILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQR KQYLNSILSPLKNIVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLKYYN SSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGRDSGKKDSFMLGLLVLD EEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQEEFK EIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLD NTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSY QAERSQLGLIRKKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTE DTGIRITRAELEKTIVEHGGKLIYNVILKRHSIGDVRLISCKTTTECKAL IDRGYDILHPNWVLDCIAYKRLILIEPNYCFNVSQKMRAVAEKRVDCLGD SFENDISETKLSSLYKSQLSLPPMGELEIDSEVRRFPLFLFSNRIAYVPR RKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEVHE KIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVVNY |
Dnl4p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| The sequence of a 30 kb fragment on the left arm of chromosome XV from Saccharomyces cerevisiae reveals 15 open reading frames, five of which correspond to previously identified genes. | Sterky F, Holmberg A, Pettersson B, Uhlen M | Yeast Sept. 1, 1996 |
| Two distinct DNA ligase activities in mitotic extracts of the yeast Saccharomyces cerevisiae. | Ramos W, Tappe N, Talamantez J, Friedberg EC, Tomkinson AE | Nucleic Acids Res April 15, 1997 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. | Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. | Nature May 1, 1997 |
| Saccharomyces cerevisiae LIF1: a function involved in DNA double-strand break repair related to mammalian XRCC4. | Herrmann G, Lindahl T, Schar P | EMBO J July 15, 1998 |
| A physical and functional interaction between yeast Pol4 and Dnl4-Lif1 links DNA synthesis and ligation in nonhomologous end joining. | Tseng HM, Tomkinson AE | J Biol Chem Nov. 22, 2002 |
| Structure of an Xrcc4-DNA ligase IV yeast ortholog complex reveals a novel BRCT interaction mode. | Dore AS, Furnham N, Davies OR, Sibanda BL, Chirgadze DY, Jackson SP, Pellegrini L, Blundell TL | DNA Repair (Amst) March 7, 2006 |
Last modification of this entry: Oct. 16, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|