Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Msh4p

Msh4p (Saccharomyces cerevisiae) is product of expression of MSH4 gene.


Msh4p is involved in:

HRR in Saccharomyces cerevisiae
     


Keywords:



FUNCTION: Involved in meiotic recombination. Facilitate crossovers between homologs during meiosis.

SUBUNIT: Heterooligomer of MSH4 and MSH5.

INTERACTION: Q06032:CST9; NbExp=1; IntAct=EBI-11371, EBI-30044; Q12175:MSH5; NbExp=2; IntAct=EBI-11371, EBI-11377;

MISCELLANEOUS: Two distinct classes of crossovers have been demonstrated in budding yeast. Class I is MSH4/MSH5 dependent and exhibits crossover interference. Class II is MUS81/MMS4 dependent and exhibits no interference.

SIMILARITY: Belongs to the DNA mismatch repair mutS family.


NCBI GenPept GI number(s): 14318519
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P40965 P40965
PFAM: - P40965 (Link - using uniprot id)
InterPro: - P40965 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSESNLSSFISTNYFNLRSAANSSNSISKPSTKKSIRNQKSPTNISSWAL
KKKTLQIAETTWENNEKDSTHSHYLMTGSMASRTATSLSRYSTNASLLGP
SIDCVLCCIYEVPRDISTRIGLCIINCNTGQMYLSDFMDSQIYIRVVHKL
QIYQPTEILIPSSSLAPTVSKLATMIKFNVAETVKIEEGSRKCFNSQDGL
AAITKYLMDDTKKDLKIEEIIDKTFALCAASAAISYMEEIISKSSRNLNA
FRKLRIQFEGTENTMLIDSKTVRGLELVENKLDKNGISLWKFLDTTSTKM
GQRSLRNSILQPLTDRGSIEMRLEALEELKANDDLLQKLRLEMKSLPDLD
KLFSRLLCINHSAIKPDQRINYVLLLKETLQSVKSLKDALNDQLIQSRLI
SETKKIFNNDAIMEIEKLINSCINEDCVWASSAIQLLNQRSYAVKSDSNG
LLDVSRQIYKEVKEEFFREVEDLTAKNKINLDHNYDSARGFYLRIKRQEF
TDDVATLPDVFISRTIKKNYIECTTLNIIKKNARLKEVMEEILLLSEETV
DELLDKIATHISELFMIAEAVAILDLVCSFTYNLKENNYTIPIFTNNLLI
RDSRHPLLEKVLKNFVPNTISSTKHSSSLQIITGCNMSGKSVYLKQVALI
CIMAQMGSGIPALYGSFPVFKRLHARVCNDSMELTSSNFGFEMKEMAYFL
DDINTETLLILDELGRGSSIADGFCVSLAVTEHLLRTEATVFLSTHFQDI
PKIMSKKPAVSHLHMDAVLLNDNSVKMNYQLTQKSVAIENSGIRVVKKIF
NPDIIAEAYNIHSLLKIAKARTENEDSNGVVDQKTINQMKRIHNLVAILK
ECAGNEKEPLTLGKLKEINSDFIENFEE

Msh4p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Mutation of a meiosis-specific MutS homolog decreases crossing over but not mismatch correction. Ross-Macdonald P, Roeder GS Cell Dec. 16, 1994
Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae. Murakami Y, Naitou M, Hagiwara H, Shibata T, Ozawa M, Sasanuma S, Sasanuma M, Tsuchiya Y, Soeda E, Yokoyama K, et al. Nat Genet July 1, 1995
Sequencing of a 23 kb fragment from Saccharomyces cerevisiae chromosome VI. Naitou M, Ozawa M, Sasanuma SI, Kobayashi M, Hagiwara H, Shibata T, Hanaoka F, Watanabe K, Ono A, Yamazaki M, Tashiro H, Eki T, Murakami Y Yeast Feb. 1, 1996
Conserved properties between functionally distinct MutS homologs in yeast. Pochart P, Woltering D, Hollingsworth NM J Biol Chem Nov. 28, 1997


Last modification of this entry: Oct. 13, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.