Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Msh5p

Msh5p (Saccharomyces cerevisiae) is product of expression of MSH5 gene.


Msh5p is involved in:

HRR in Saccharomyces cerevisiae
     


Keywords:



FUNCTION: Involved in meiotic recombination. Facilitate crossovers between homologs during meiosis.

SUBUNIT: Heterooligomer of MSH4 and MSH5.

INTERACTION: P40965:MSH4; NbExp=2; IntAct=EBI-11377, EBI-11371;

MISCELLANEOUS: Two distinct classes of crossovers have been demonstrated in budding yeast. Class I is MSH4/MSH5 dependent and exhibits crossover interference. Class II is MUS81/MMS4 dependent and exhibits no interference.

SIMILARITY: Belongs to the DNA mismatch repair mutS family.


NCBI GenPept GI number(s): 6320047
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q12175 Q12175
PFAM: - Q12175 (Link - using uniprot id)
InterPro: - Q12175 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSHEWLISASETMRSIGNGEGLRDKGAVVANNDGEFNEGDTNREEDSSTI
FSFDFDEEIVMCIDFSGGKLGCSILDYHTKTLKAFDQDYVVNKTTISSHD
LIDDADMSSNDISLLLGLLIMEANPTVCLVPARLEDWIFDYIKTKCDEIN
CRLELQPIKRFKKWDLLQSLQLRGHDNQTILNDILSNSKFTTTVTLGTVG
CILANHEQLGEYNDSTASSNMVTGRLVQNAFEDVIHGIRYIDIRDRMVLD
ENTISALHIFPTAHKLGHDKMMRNGFFSVFELFNQVSSDYARRILKSWLI
NPLTNKKRIETRYSIIRTLLDKQNAIIFSDLSQSIKRCPDAFGFINQLRS
GKSTLGTWSKVASFLEKGIAIFQLVSSLKLGSDEANILHDIKNKVDISAL
KECLRKVETVIDFDTSRDTKTLTINTGVDNRLDECRNIYNHLEGILLDVA
RETQIFLLNTMPQEDCKTTKSLEKLVNAVYIPQLGYLVTISVLMEPLLDG
IPNLQWEEIFRSSENIYFKNGRVLELDETYGDIYGAISDFEIEILFSLQE
QILRRKTQLTAYNILLSELEILLSFAQVSAERNYAEPQLVEDECILEIIN
GRHALYETFLDNYIPNSTMIDGGLFSELSWCEQNKGRIIVVTGANASGKS
VYLTQNGLIVYLAQIGCFVPAERARIGIADKILTRIRTQETVYKTQSSFL
LDSQQMAKSLSLATEKSLILIDEYGKGTDILDGPSLFGSIMLNMSKSEKC
PRIIACTHFHELFNENVLTENIKGIKHYCTDILISQKYNLLETAHVGEDH
ESEGITFLFKVKEGISKQSFGIYCAKVCGLSRDIVERAEELSRMINRGDD
VVQQCGNLTEKEMREFQKNQEIVKKFLSWDLDLETTTTSENLRLKLKNFL
R

Msh5p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
MSH5, a novel MutS homolog, facilitates meiotic reciprocal recombination between homologs in Saccharomyces cerevisiae but not mismatch repair. Hollingsworth NM, Ponte L, Halsey C Genes Dev July 15, 1995
Analysis of a 23 kb region on the left arm of yeast chromosome IV. Delaveau T, Blugeon C, Jacq C, Perea J Yeast Dec. 1, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. Nature May 1, 1997
Conserved properties between functionally distinct MutS homologs in yeast. Pochart P, Woltering D, Hollingsworth NM J Biol Chem Nov. 28, 1997


Last modification of this entry: Oct. 13, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.