Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ntg2p

Protein FULL name:

DNA N-glycosylase and apurinic/apyrimidinic (AP) lyase involved in base excision repair, localizes to the nucleus; sumoylated


Protein SHORT name:

NTG2, SCR2


Ntg2p (Saccharomyces cerevisiae) is product of expression of NTG2 gene.


Ntg2p is involved in:

BER in Saccharomyces cerevisiae
     


Keywords:



FUNCTION: Excision repair N-glycosylase involved in the repair of DNA base damage in the nucleus. NTG2 can use dihydrothymine (poor substrate), urea, and uracil glycol are substrates.

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: Present with 125 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the nth/mutY family.


NCBI GenPept GI number(s): 6324530
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q08214 Q08214
PFAM: - Q08214 (Link - using uniprot id)
InterPro: - Q08214 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MREESRSRKRKHIPVDIEEVEVRSKYFKKNERTVELVKENKINKDLQNYG
GVNIDWIKALKPIEYFEWIESRTCDDPRTWGRPITKEEMINDSGAKVPES
FLPIYNRVRLMRSKVKTPVDAMGCSMIPVLVSNKCGIPSEKVDPKNFRLQ
FLIGTMLSAQTRDERMAQAALNITEYCLNTLKIAEGITLDGLLKIDEPVL
ANLIRCVSFYTRKANFIKRTAQLLVDNFDSDIPYDIEGILSLPGVGPKMG
YLTLQKGWGLIAGICVDVHVHRLCKMWNWVDPIKCKTAEHTRKELQVWLP
HSLWYEINTVLVGFGQLICMARGKRCDLCLANDVCNARNEKLIESSKFHQ
LEDKEDIEKVYSHWLDTVTNGITTERHKKK

Ntg2p (Saccharomyces cerevisiae) is able to recognize following damages:
Ntg2p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. Nature May 1, 1997
Saccharomyces cerevisiae Ntg1p and Ntg2p: broad specificity N-glycosylases for the repair of oxidative DNA damage in the nucleus and mitochondria. You HJ, Swanson RL, Harrington C, Corbett AH, Jinks-Robertson S, Senturker S, Wallace SS, Boiteux S, Dizdaroglu M, Doetsch PW Biochemistry Aug. 31, 1999
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003


Last modification of this entry: Oct. 14, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.