Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Pol4p

Protein FULL name:

DNA polymerase IV, undergoes pair-wise interactions with Dnl4p-Lif1p and Rad27p to mediate repair of DNA double-strand breaks by non-homologous end joining (NHEJ); homologous to mammalian DNA polymerase beta


Pol4p (Saccharomyces cerevisiae) is product of expression of POL4 gene.


Pol4p is involved in:

NHEJ in Saccharomyces cerevisiae

Keywords:



FUNCTION: Repair polymerase. Involved in gap-filling in DNA nonhomologous end joining (NHEJ) required for double-strand break repair. Seems to conduct DNA synthesis in a stepwise distributive fashion rather than in a processive fashion as for other DNA polymerases. Preferentially acts upon short gaps formed by the alignment of linear duplexes with complementary single-strand ends. Required for filling gaps that need removal of a 5'- or 3'- terminal mismatch, however lacks nuclease activities.

CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).

COFACTOR: Magnesium (By similarity).

ENZYME REGULATION: Stimulated by the interaction with the DNL4- LIF1 complex.

SUBUNIT: Interacts with DNL4 subunit of the DNL4-LIF1 complex.

INTERACTION: P53879:RHO5; NbExp=1; IntAct=EBI-6115, EBI-29054; P09959:SWI6; NbExp=1; IntAct=EBI-6115, EBI-18641;

SUBCELLULAR LOCATION: Nucleus.

INDUCTION: During meiosis.

SIMILARITY: Belongs to the DNA polymerase type-X family.


NCBI GenPept GI number(s): 10383782
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P25615 P25615
PFAM: - P25615 (Link - using uniprot id)
InterPro: - P25615 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSLKGKFFAFLPNPNTSSNKFFKSILEKKGATIVSSIQNCLQSSRKEVVI
LIEDSFVDSDMHLTQKDIFQREAGLNDVDEFLGKIEQSGIQCVKTSCITK
WVQNDKFAFQKDDLIKFQPSIIVISDNADDGQSSTDKESEISTDVESERN
DDSNNKDMIQASKPLKRLLQGDKGRASLVTDKTKYKNNELIIGALKRLTK
KYEIEGEKFRARSYRLAKQSMENCDFNVRSGEEAHTKLRNIGPSIAKKIQ
VILDTGVLPGLNDSVGLEDKLKYFKNCYGIGSEIAKRWNLLNFESFCVAA
KKDPEEFVSDWTILFGWSYYDDWLCKMSRNECFTHLKKVQKALRGIDPEC
QVELQGSYNRGYSKCGDIDLLFFKPFCNDTTELAKIMETLCIKLYKDGYI
HCFLQLTPNLEKLFLKRIVERFRTAKIVGYGERKRWYSSEIIKKFFMGVK
LSPRELEELKEMKNDEGTLLIEEEEEEETKLKPIDQYMSLNAKDGNYCRR
LDFFCCKWDELGAGRIHYTGSKEYNRWIRILAAQKGFKLTQHGLFRNNIL
LESFNERRIFELLNLKYAEPEHRNIEWEKKTA

Pol4p (Saccharomyces cerevisiae) is able to recognize following damages:
Pol4p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
The complete sequence of a 10.8 kb segment distal of SUF2 on the right arm of chromosome III from Saccharomyces cerevisiae reveals seven open reading frames including the RVS161, ADP1 and PGK genes. Skala J, Purnelle B, Goffeau A Yeast May 1, 1992
The complete DNA sequence of yeast chromosome III. Oliver SG, van der Aart QJ, Agostoni-Carbone ML, Aigle M, Alberghina L, Alexandraki D, Antoine G, Anwar R, Ballesta JP, Benit P, et al. Nature May 7, 1992
Comprehensive sequence analysis of the 182 predicted open reading frames of yeast chromosome III. Bork P, Ouzounis C, Sander C, Scharf M, Schneider R, Sonnhammer E Protein Sci Dec. 1, 1992
Yeast open reading frame YCR14C encodes a DNA beta-polymerase-like enzyme. Prasad R, Widen SG, Singhal RK, Watkins J, Prakash L, Wilson SH Nucleic Acids Res Nov. 25, 1993
The yeast Saccharomyces cerevisiae DNA polymerase IV: possible involvement in double strand break DNA repair. Leem SH, Ropp PA, Sugino A Nucleic Acids Res Aug. 11, 1994
Efficient processing of DNA ends during yeast nonhomologous end joining. Evidence for a DNA polymerase beta (Pol4)-dependent pathway. Wilson TE, Lieber MR J Biol Chem Aug. 13, 1999
A physical and functional interaction between yeast Pol4 and Dnl4-Lif1 links DNA synthesis and ligation in nonhomologous end joining. Tseng HM, Tomkinson AE J Biol Chem Nov. 22, 2002


Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.