Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Mms2p |
FUNCTION: Has a role in the DNA error-free postreplication repair (PRR) pathway. Lacks catalytic activity by itself. The UBC13/MMS2 heterodimer catalyzes the synthesis of non-canonical poly- ubiquitin chains that are linked through 'Lys-63'.
SUBUNIT: Heterodimer with UBC13.
INTERACTION: P53751:-; NbExp=1; IntAct=EBI-11035, EBI-28557; P40210:SIP5; NbExp=1; IntAct=EBI-11035, EBI-27280; P52490:UBC13; NbExp=2; IntAct=EBI-11035, EBI-19777;
MISCELLANEOUS: Present with 2760 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the ubiquitin-conjugating enzyme family.
| NCBI GenPept GI number(s): |
6321351 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P53152 |
P53152 |
| PFAM: | - |
P53152 (Link - using uniprot id) |
| InterPro: | - |
P53152 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSKVPRNFRLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPH SNHENRIYSLSIDCGPNYPDSPPKVTFISKINLPCVNPTTGEVQTDFHTL RDWKRAYTMETLLLDLRKEMATPANKKLRQPKEGETF |
Mms2p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome VII. | Tettelin H, Agostoni Carbone ML, Albermann K, Albers M, Arroyo J, Backes U, Barreiros T, Bertani I, Bjourson AJ, Bruckner M, Bruschi CV, Carignani G, Castagnoli L, Cerdan E, Clemente ML, Coblenz A, Coglievina M, Coissac E, Defoor E, Del Bino S, Delius H, Delneri D, de Wergifosse P, Dujon B, Kleine K, et al. | Nature May 1, 1997 |
| Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII. | Rieger M, Bruckner M, Schafer M, Muller-Auer S | Yeast Sept. 15, 1997 |
| MMS2, encoding a ubiquitin-conjugating-enzyme-like protein, is a member of the yeast error-free postreplication repair pathway. | Broomfield S, Chow BL, Xiao W | Proc Natl Acad Sci U S A May 12, 1998 |
| The products of the yeast MMS2 and two human homologs (hMMS2 and CROC-1) define a structurally and functionally conserved Ubc-like protein family. | Xiao W, Lin SL, Broomfield S, Chow BL, Wei YF | Nucleic Acids Res Sept. 1, 1998 |
| Noncanonical MMS2-encoded ubiquitin-conjugating enzyme functions in assembly of novel polyubiquitin chains for DNA repair. | Hofmann RM, Pickart CM | Cell March 5, 1999 |
| Molecular insights into polyubiquitin chain assembly: crystal structure of the Mms2/Ubc13 heterodimer. | VanDemark AP, Hofmann RM, Tsui C, Pickart CM, Wolberger C | Cell June 15, 2001 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| A multidimensional chromatography technology for in-depth phosphoproteome analysis. | Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H | Mol Cell Proteomics July 1, 2008 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|