Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Mms2p

Mms2p (Saccharomyces cerevisiae) is product of expression of MMS2 gene.






FUNCTION: Has a role in the DNA error-free postreplication repair (PRR) pathway. Lacks catalytic activity by itself. The UBC13/MMS2 heterodimer catalyzes the synthesis of non-canonical poly- ubiquitin chains that are linked through 'Lys-63'.

SUBUNIT: Heterodimer with UBC13.

INTERACTION: P53751:-; NbExp=1; IntAct=EBI-11035, EBI-28557; P40210:SIP5; NbExp=1; IntAct=EBI-11035, EBI-27280; P52490:UBC13; NbExp=2; IntAct=EBI-11035, EBI-19777;

MISCELLANEOUS: Present with 2760 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the ubiquitin-conjugating enzyme family.


NCBI GenPept GI number(s): 6321351
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P53152 P53152
PFAM: - P53152 (Link - using uniprot id)
InterPro: - P53152 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSKVPRNFRLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPH
SNHENRIYSLSIDCGPNYPDSPPKVTFISKINLPCVNPTTGEVQTDFHTL
RDWKRAYTMETLLLDLRKEMATPANKKLRQPKEGETF

Mms2p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
The nucleotide sequence of Saccharomyces cerevisiae chromosome VII. Tettelin H, Agostoni Carbone ML, Albermann K, Albers M, Arroyo J, Backes U, Barreiros T, Bertani I, Bjourson AJ, Bruckner M, Bruschi CV, Carignani G, Castagnoli L, Cerdan E, Clemente ML, Coblenz A, Coglievina M, Coissac E, Defoor E, Del Bino S, Delius H, Delneri D, de Wergifosse P, Dujon B, Kleine K, et al. Nature May 1, 1997
Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII. Rieger M, Bruckner M, Schafer M, Muller-Auer S Yeast Sept. 15, 1997
MMS2, encoding a ubiquitin-conjugating-enzyme-like protein, is a member of the yeast error-free postreplication repair pathway. Broomfield S, Chow BL, Xiao W Proc Natl Acad Sci U S A May 12, 1998
The products of the yeast MMS2 and two human homologs (hMMS2 and CROC-1) define a structurally and functionally conserved Ubc-like protein family. Xiao W, Lin SL, Broomfield S, Chow BL, Wei YF Nucleic Acids Res Sept. 1, 1998
Noncanonical MMS2-encoded ubiquitin-conjugating enzyme functions in assembly of novel polyubiquitin chains for DNA repair. Hofmann RM, Pickart CM Cell March 5, 1999
Molecular insights into polyubiquitin chain assembly: crystal structure of the Mms2/Ubc13 heterodimer. VanDemark AP, Hofmann RM, Tsui C, Pickart CM, Wolberger C Cell June 15, 2001
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics July 1, 2008


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.