Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Rad27p

Protein FULL name:

5' to 3' exonuclease, 5' flap endonuclease, required for Okazaki fragment processing and maturation as well as for long-patch base-excision repair; member of the S. pombe RAD2/FEN1 family


Protein SHORT name:

ERC11, FEN1, RTH1


Rad27p (Saccharomyces cerevisiae) is product of expression of RAD27 gene.


Rad27p is involved in:

NHEJ in Saccharomyces cerevisiae BER in Saccharomyces cerevisiae




FUNCTION: Single-stranded DNA endonuclease (Probable).

COFACTOR: Binds 2 magnesium ions per subunit. They probably participate in the reaction catalyzed by the enzyme. May bind an additional third magnesium ion after substrate binding (By similarity).

INTERACTION: P38859:DNA2; NbExp=1; IntAct=EBI-14693, EBI-5973; P47135:JSN1; NbExp=1; IntAct=EBI-14693, EBI-9422; P15873:POL30; NbExp=1; IntAct=EBI-14693, EBI-12993;

SUBCELLULAR LOCATION: Nucleus (Probable).

MISCELLANEOUS: Present with 6120 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the XPG/RAD2 endonuclease family. FEN1 subfamily.


NCBI GenPept GI number(s): 6322736
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P26793 P26793
PFAM: - P26793 (Link - using uniprot id)
InterPro: - P26793 (Link - using uniprot id)
CATH: None  
SCOP: None  
PDB: - -


Protein sequence:
MGIKGLNAIISEHVPSAIRKSDIKSFFGRKVAIDASMSLYQFLIAVRQQD
GGQLTNEAGETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPDLKSHELTK
RSSRRVETEKKLAEATTELEKMKQERRLVKVSKEHNEEAQKLLGLMGIPY
IIAPTEAEAQCAELAKKGKVYAAASEDMDTLCYRTPFLLRHLTFSEAKKE
PIHEIDTELVLRGLDLTIEQFVDLCIMLGCDYCESIRGVGPVTALKLIKT
HGSIEKIVEFIESGESNNTKWKIPEDWPYKQARMLFLDPEVIDGNEINLK
WSPPKEKELIEYLCDDKKFSEERVKSGISRLKKGLKSGIQGRLDGFFQVV
PKTKEQLAAAAKRAQENKKLNKNKNKVTKGRR

Rad27p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Sequence of a 10.7 kb segment of yeast chromosome XI identifies the APN1 and the BAF1 loci and reveals one tRNA gene and several new open reading frames including homologs to RAD2 and kinases. Jacquier A, Legrain P, Dujon B Yeast Jan. 1, 1992
Functional domains within FEN-1 and RAD2 define a family of structure-specific endonucleases: implications for nucleotide excision repair. Harrington JJ, Lieber MR Genes Dev June 1, 1994
Complete DNA sequence of yeast chromosome XI. Dujon B, Alexandraki D, Andre B, Ansorge W, Baladron V, Ballesta JP, Banrevi A, Bolle PA, Bolotin-Fukuhara M, Bossier P, et al. Nature June 2, 1994
Characterization of a mutant strain of Saccharomyces cerevisiae with a deletion of the RAD27 gene, a structural homolog of the RAD2 nucleotide excision repair gene. Reagan MS, Pittenger C, Siede W, Friedberg EC J Bacteriol Feb. 1, 1995
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.