Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Rad4p

Protein FULL name:

Protein that recognizes and binds damaged DNA (with Rad23p) during nucleotide excision repair; subunit of Nuclear Excision Repair Factor 2 (NEF2); homolog of human XPC protein


Rad4p (Saccharomyces cerevisiae) is product of expression of RAD4 gene.


Rad4p is involved in:

NER in Saccharomyces cerevisiae




FUNCTION: Involved in nucleotide excision repair of DNA damaged with UV light, bulky adducts, or cross-linking agents.

INTERACTION: P18480:SNF5; NbExp=1; IntAct=EBI-14766, EBI-17546; P18888:SNF6; NbExp=1; IntAct=EBI-14766, EBI-17550;

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: Present with 876 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the XPC family.


NCBI GenPept GI number(s): 6321010
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P14736 P14736
PFAM: - P14736 (Link - using uniprot id)
InterPro: - P14736 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MNEDLPKEYFELIRKALNEKEAEKAPLSRRRRVRRKNQPLPDAKKKFKTG
LNELPRESVVTVNLDSSDDGVVTVPTDDSVEEIQSSEEDYDSEEFEDVTD
GNEVAGVEDISVEIKPSSKRNSDARRTSRNVCSNEERKRRKYFHMLYLVC
LMVHGFIRNEWINSKRLSRKLSNLVPEKVFELLHPQKDEELPLRSTRKLL
DGLKKCMELWQKHWKITKKYDNEGLYMRTWKEIEMSANNKRKFKTLKRSD
FLRAVSKGHGDPDISVQGFVAMLRACNVNARLIMSCQPPDFTNMKIDTSL
NGNNAYKDMVKYPIFWCEVWDKFSKKWITVDPVNLKTIEQVRLHSKLAPK
GVACCERNMLRYVIAYDRKYGCRDVTRRYAQWMNSKVRKRRITKDDFGEK
WFRKVITALHHRKRTKIDDYEDQYFFQRDESEGIPDSVQDLKNHPYYVLE
QDIKQTQIVKPGCKECGYLKVHGKVGKVLKVYAKRDIADLKSARQWYMNG
RILKTGSRCKKVIKRTVGRPKGEAEEEDERLYSFEDTELYIPPLASASGE
ITKNTFGNIEVFAPTMIPGNCCLVENPVAIKAARFLGVEFAPAVTSFKFE
RGSTVKPVLSGIVVAKWLREAIETAIDGIEFIQEDDNRKEHLLGALESWN
TLLLKLRIRSKLNSTYGKIAEEEPNVTKEQNIADNHDNTETFMGGGFLPG
IANHEARPYSEPSEPEDSLDYVSVDKAEESATDDDVGEDYSDFMKELEMS
EESD

Rad4p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Cloning and nucleotide sequence analysis of the Saccharomyces cerevisiae RAD4 gene required for excision repair of UV-damaged DNA. Gietz RD, Prakash S Gene Dec. 1, 1988
Nucleotide sequence of the wild-type RAD4 gene of Saccharomyces cerevisiae and characterization of mutant rad4 alleles. Couto LB, Friedberg EC J Bacteriol April 1, 1989
The nucleotide sequence of Saccharomyces cerevisiae chromosome V. Dietrich FS, Mulligan J, Hennessy K, Yelton MA, Allen E, Araujo R, Aviles E, Berno A, Brennan T, Carpenter J, Chen E, Cherry JM, Chung E, Duncan M, Guzman E, Hartzell G, Hunicke-Smith S, Hyman RW, Kayser A, Komp C, Lashkari D, Lew H, Lin D, Mosedale D, Davis RW, et al. Nature May 1, 1997
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.