Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Rad1p

Rad1p (Saccharomyces cerevisiae) is product of expression of RAD1 gene.


Rad1p is involved in:

NER in Saccharomyces cerevisiae

Keywords:



FUNCTION: Involved in nucleotide excision repair of DNA damaged with UV light, bulky adducts, or cross-linking agents. Along with RAD10 forms an endonuclease that specifically degrades single- stranded DNA.

SUBUNIT: Component of the nucleotide excision repair factor 1 (NEF1) complex consisting of RAD1, RAD10 and RAD14. Interacts with SAW1.

INTERACTION: P06838:RAD10; NbExp=1; IntAct=EBI-14752, EBI-14637; P28519:RAD14; NbExp=1; IntAct=EBI-14752, EBI-14641; P39735:SAW1; NbExp=1; IntAct=EBI-14752, EBI-20627; Q12098:SLX4; NbExp=1; IntAct=EBI-14752, EBI-37788;

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: Present with 1400 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the XPF family.

SIMILARITY: Contains 1 ERCC4 domain.

SEQUENCE CAUTION: Sequence=AAA34929.1; Type=Frameshift; Positions=923, 934, 948;


NCBI GenPept GI number(s): 6325235
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P06777 P06777
PFAM: - P06777 (Link - using uniprot id)
InterPro: - P06777 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSQLFYQGDSDDELQEELTRQTTQASQSSKIKNEDEPDDSNHLNEVENED
SKVLDDDAVLYPLIPNEPDDIETSKPNINDIRPVDIQLTLPLPFQQKVVE
NSLITEDALIIMGKGLGLLDIVANLLHVLATPTSINGQLKRALVLVLNAK
PIDNVRIKEALEELSWFSNTGKDDDDTAVESDDELFERPFNVVTADSLSI
EKRRKLYISGGILSITSRILIVDLLSGIVHPNRVTGMLVLNADSLRHNSN
ESFILEIYRSKNTWGFIKAFSEAPETFVMEFSPLRTKMKELRLKNVLLWP
RFRVEVSSCLNATNKTSHNKVIEVKVSLTNSMSQIQFGLMECLKKCIAEL
SRKNPELALDWWNMENVLDINFIRSIDSVMVPNWHRISYESKQLVKDIRF
LRHLLKMLVTSDAVDFFGEIQLSLDANKPSVSRKYSESPWLLVDEAQLVI
SYAKKRIFYKNEYTLEENPKWEQLIHILHDISHERMTNHLQGPTLVACSD
NLTCLELAKVLNASNKKRGVRQVLLNKLKWYRKQREETKKLVKEVQSQDT
FPENATLNVSSTFSKEQVTTKRRRTRGASQVAAVEKLRNAGTNVDMEVVF
EDHKLSEEIKKGSGDDLDDGQEENAANDSKIFEIQEQENEILIDDGDAEF
DNGELEYVGDLPQHITTHFNKDLWAEHCNEYEYVDRQDEILISTFKSLND
NCSLQEMMPSYIIMFEPDISFIRQIEVYKAIVKDLQPKVYFMYYGESIEE
QSHLTAIKREKDAFTKLIRENANLSHHFETNEDLSHYKNLAERKLKLSKL
RKSNTRNAGGQQGFHNLTQDVVIVDTREFNASLPGLLYRYGIRVIPCMLT
VGDYVITPDICLERKSISDLIGSLQNNRLANQCKKMLKYYAYPTLLIEFD
EGQSFSLEPFSERRNYKNKDISTVHPISSKLSQDEIQLKLAKLVLRFPTL
KIIWSSSPLQTVNIILELKLGREQPDPSNAVILGTNKVRSDFNSTAKGLK
DGDNESKFKRLLNVPGVSKIDYFNLRKKIKSFNKLQKLSWNEINELINDE
DLTDRIYYFLRTEKEEQEQESTDENLESPGKTTDDNALHDHHNDVPEAPV

Rad1p (Saccharomyces cerevisiae) is able to recognize following damages:
Rad1p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Molecular cloning and nucleotide sequence analysis of the Saccharomyces cerevisiae RAD1 gene. Yang E, Friedberg EC Mol Cell Biol Oct. 1, 1984
Nucleotide sequence and functional analysis of the RAD1 gene of Saccharomyces cerevisiae. Reynolds P, Prakash L, Prakash S Mol Cell Biol March 1, 1987
Yeast DNA repair and recombination proteins Rad1 and Rad10 constitute a single-stranded-DNA endonuclease. Tomkinson AE, Bardwell AJ, Bardwell L, Tappe NJ, Friedberg EC Nature April 1, 1993
Nucleotide excision repair in yeast is mediated by sequential assembly of repair factors and not by a pre-assembled repairosome. Guzder SN, Sung P, Prakash L, Prakash S J Biol Chem April 12, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI. Bussey H, Storms RK, Ahmed A, Albermann K, Allen E, Ansorge W, Araujo R, Aparicio A, Barrell B, Badcock K, Benes V, Botstein D, Bowman S, Bruckner M, Carpenter J, Cherry JM, Chung E, Churcher C, Coster F, Davis K, Davis RW, Dietrich FS, Delius H, DiPaolo T, Hani J, et al. Nature May 1, 1997
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A June 19, 2007
Examining protein protein interactions using endogenously tagged yeast arrays: the cross-and-capture system. Suter B, Fetchko MJ, Imhof R, Graham CI, Stoffel-Studer I, Zbinden C, Raghavan M, Lopez L, Beneti L, Hort J, Fillingham J, Greenblatt JF, Giaever G, Nislow C, Stagljar I Genome Res Dec. 1, 2007
Microarray-based genetic screen defines SAW1, a gene required for Rad1/Rad10-dependent processing of recombination intermediates. Li F, Dong J, Pan X, Oum JH, Boeke JD, Lee SE Mol Cell May 9, 2008


Last modification of this entry: Oct. 21, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.