Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

TFB1

Protein FULL name:

Subunit of TFIIH and nucleotide excision repair factor 3 complexes, required for nucleotide excision repair, target for transcriptional activators


TFB1 (Saccharomyces cerevisiae) is product of expression of TFB1 gene.



Keywords:



FUNCTION: Acts as component of the general transcription and DNA repair factor IIH (TFIIH) core, which is essential for both basal and activated transcription, and is involved in nucleotide excision repair (NER) of damaged DNA. TFIIH has CTD kinase and DNA-dependent ATPase activity, and is essential for polymerase II transcription in vitro.

SUBUNIT: Component of the TFIIH core complex, which is composed of RAD3, SSL1, SSL2, TFB1, TFB2, TFB4 and TFB5.

INTERACTION: P14904:APE1; NbExp=1; IntAct=EBI-19146, EBI-2571; Q06410:ATG17; NbExp=1; IntAct=EBI-19146, EBI-30856; P35193:ATG19; NbExp=1; IntAct=EBI-19146, EBI-29291; P53271:COG2; NbExp=1; IntAct=EBI-19146, EBI-16614; P36156:ECM4; NbExp=1; IntAct=EBI-19146, EBI-2042717; P36224:JNM1; NbExp=1; IntAct=EBI-19146, EBI-9415; Q02574:MEC3; NbExp=1; IntAct=EBI-19146, EBI-10658; Q03935:YAP6; NbExp=1; IntAct=EBI-19146, EBI-37603;

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: Present with 5150 molecules/cell in log phase SD medium.

SIMILARITY: Contains 2 BSD domains.


This protein can be a part of a given complexes:
NCBI GenPept GI number(s): 6320517
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P32776 P32776
PFAM: - P32776 (Link - using uniprot id)
InterPro: - P32776 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQA
TPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNI
KMTLQQIISRYKDADIYEEKRRREESAQHTETPMSSSSVTAGTPTPHLDT
PQLNNGAPLINTAKLDDSLSKEKLLTNLKLQQSLLKGNKVLMKVFQETVI
NAGLPPSEFWSTRIPLLRAFALSTSQKVGPYNVLSTIKPVASSENKVNVN
LSREKILNIFENYPIVKKAYTDNVPKNFKEPEFWARFFSSKLFRKLRGEK
IMQNDRGDVIIDRYLTLDQEFDRKDDDMLLHPVKKIIDLDGNIQDDPVVR
GNRPDFTMQPGVDINGNSDGTVDILKGMNRLSEKMIMALKNEYSRTNLQN
KSNITNDEEDEDNDERNELKIDDLNESYKTNYAIIHLKRNAHEKTTDNDA
KSSADSIKNADLKVSNQQMLQQLSLVMDNLINKLDLNQVVPNNEVSNKIN
KRVITAIKINAKQAKHNNVNSALGSFVDNTSQANELEVKSTLPIDLLESC
RMLHTTCCEFLKHFYIHFQSGEQKQASTVKKLYNHLKDCIEKLNELFQDV
LNGDGESMSNTCTAYLKPVLNSITLATHKYDEYFNEYNNNSN

TFB1 (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Cloning of a subunit of yeast RNA polymerase II transcription factor b and CTD kinase. Gileadi O, Feaver WJ, Kornberg RD Science Sept. 4, 1992
RNA polymerase transcription factor IIH holoenzyme from yeast. Svejstrup JQ, Feaver WJ, LaPointe J, Kornberg RD J Biol Chem Nov. 11, 1994
Reconstitution of TFIIH and requirement of its DNA helicase subunits, Rad3 and Rad25, in the incision step of nucleotide excision repair. Sung P, Guzder SN, Prakash L, Prakash S J Biol Chem May 3, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. Nature May 1, 1997
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Revised subunit structure of yeast transcription factor IIH (TFIIH) and reconciliation with human TFIIH. Takagi Y, Komori H, Chang WH, Hudmon A, Erdjument-Bromage H, Tempst P, Kornberg RD J Biol Chem Nov. 7, 2003
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics July 1, 2008


Last modification of this entry: Oct. 19, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.